NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23267.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23267.1 Public Mus musculus 9 Cln6 16 104 75 CCDS HistoryNCBI Gene:76524Re-query CCDS DB by CCDS ID:23267.1Re-query CCDS DB by GeneID:76524See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23267.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000034776 ENSMUSP00000034776 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000034776Link to Ensembl Protein Viewer:ENSMUSP00000034776Re-query CCDS DB by Nucleotide ID:ENSMUST00000034776Re-query CCDS DB by Protein ID:ENSMUSP00000034776
Original member Current member EBI,WTSI OTTMUST00000083630 OTTMUSP00000044963 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000083630Link to Vega Protein Viewer:OTTMUSP00000044963Re-query CCDS DB by Nucleotide ID:OTTMUST00000083630Re-query CCDS DB by Protein ID:OTTMUSP00000044963
Original member Current member NCBI NM_001033175.2 NP_001028347.1 Accepted alive Link to Nucleotide Sequence:NM_001033175.2Link to Protein Sequence:NP_001028347.1Re-query CCDS DB by Nucleotide ID:NM_001033175Re-query CCDS DB by Protein ID:NP_001028347Link to BLink:NP_001028347.1

Chromosomal Locations for CCDS 23267.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 62838881 62838954 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 62844570 62844684 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 62845954 62846052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 62846966 62847154 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 62847585 62847640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 62849109 62849231 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 62850617 62850887 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (927 nt):
ATGGAGGCGGCGACGCGGAGGCGGCAGCTCCTCGGAGCGGCGGGCGGCCCCGGTGTCGCGTTCGTGCAGG
CC
AGGCATGGCTCTGTGAAGGCCGAGGACAAAGACCGCACAGCCCCCTTCCATCTTGACCTCTGGTTCTA
C
TTCACACTGCAGAACTGGGTTCTGGACTTTGGCCGCCCCATTGCCATGCTGGTATTCCCGATCCAGTGG
TTT
CCTCTCAACAAGCCAAGTGTCGGGGACTACTTTCACATGACCTACAACATCATCACGCCCTTCCTGC
TG
CTAAAGCTTATTGAGCGGTCCCCCCGAACGCTGCCGCGGTCTATAGTCTATGTCAGCATCATCACTTT
C
ATCATGGGAGCCAGCATCCACCTGGTGGGAGACTCAGTCAACCATCGCCTGCTCTTCAGTGGGTACCAG
CAC
CACCTGTCCGTCAGAGAGAACCCCATTATCAAGAACCTCAAGCCGGAGACTCTGATCGACTCCTTTG
AG
CTGTTGTACTACTATGACGAGTACCTGGGCCACTGCATGTGGTACATCCCCTTCTTCCTCATCCTCTT
C
ATGTACTTCAGTGGCTGTTTCACCACCTGCAAGGCTGAGAGCCACATGCCAGGACCTGCCCTGCTCCTG
GTG
GTGCCCAGTGGTCTGTACTACTGGTACCTGGTCACCGAGGGCCAGATCTTCATCCTCTTCATCTTCA
CC
TTCTTCGCCATGCTGGCTCTCGTCTTGCACCAGAAGCGCAGGCGCCTCTTCCTGGACAGCAACGGCCT
C
TTCCTCTTGTATTCCTTCGCGCTCACCCTCTCACTGGTGGCTCTGTGGGTGGCTTGGCTGTGGAATGAC
CCT
GTACTCAGAAAGAAGTACCCTGGTGTCATCTATGTTCCTGAGCCCTGGGCCTTCTACACACTCCACG
TT
AGCAGTCAACAGTGA


Translation (308 aa):
MEAATRRRQLLGAAGGPGVAFVQARHGSVKAEDKDRTAPFHLDLWFYFTLQNWVLDFGRPIAMLVFPIQW
F
PLNKPSVGDYFHMTYNIITPFLLLK
LIERSPRTLPRSIVYVSIITFIMGASIHLVGDSVNHRLLFSGYQ
H
HLSVRENPIIKNLKPETL
IDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTTCKAESHMPGPALLL
V
VPSGLYY
WYLVTEGQIFILFIFTFFAMLALVLHQKRRRLFLDSNGLFLLYSFALTLSLVALWVAWLWND
P
VLRKKYPGVIYVPEPWAFYTLHVSSQQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser