NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8440.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8440.1 Public Homo sapiens 11 HSPA8 17 106 76 CCDS HistoryNCBI Gene:3312Re-query CCDS DB by CCDS ID:8440.1Re-query CCDS DB by GeneID:3312

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 8440.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000227378 ENSP00000227378 Accepted alive Link to Ensembl Transcript Viewer:ENST00000227378Link to Ensembl Protein Viewer:ENSP00000227378Re-query CCDS DB by Nucleotide ID:ENST00000227378Re-query CCDS DB by Protein ID:ENSP00000227378
Original member Current member EBI,WTSI ENST00000534624 ENSP00000432083 Accepted alive Link to Ensembl Transcript Viewer:ENST00000534624Link to Ensembl Protein Viewer:ENSP00000432083Re-query CCDS DB by Nucleotide ID:ENST00000534624Re-query CCDS DB by Protein ID:ENSP00000432083
Original member Current member EBI,WTSI ENST00000532636 ENSP00000437125 Accepted alive Link to Ensembl Transcript Viewer:ENST00000532636Link to Ensembl Protein Viewer:ENSP00000437125Re-query CCDS DB by Nucleotide ID:ENST00000532636Re-query CCDS DB by Protein ID:ENSP00000437125
Original member Current member EBI,WTSI OTTHUMT00000387515 OTTHUMP00000231743 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000387515Link to Vega Protein Viewer:OTTHUMP00000231743Re-query CCDS DB by Nucleotide ID:OTTHUMT00000387515Re-query CCDS DB by Protein ID:OTTHUMP00000231743
Original member Current member EBI,WTSI OTTHUMT00000387518 OTTHUMP00000231745 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000387518Link to Vega Protein Viewer:OTTHUMP00000231745Re-query CCDS DB by Nucleotide ID:OTTHUMT00000387518Re-query CCDS DB by Protein ID:OTTHUMP00000231745
Original member Current member EBI,WTSI OTTHUMT00000387521 OTTHUMP00000231747 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000387521Link to Vega Protein Viewer:OTTHUMP00000231747Re-query CCDS DB by Nucleotide ID:OTTHUMT00000387521Re-query CCDS DB by Protein ID:OTTHUMP00000231747
Original member Current member NCBI NM_006597.5 NP_006588.1 Accepted alive Link to Nucleotide Sequence:NM_006597.5Link to Protein Sequence:NP_006588.1Re-query CCDS DB by Nucleotide ID:NM_006597Re-query CCDS DB by Protein ID:NP_006588Link to BLink:NP_006588.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006588.1 646 P11142-1 646 100% 0 0

Chromosomal Locations for CCDS 8440.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 123057734 123057919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 123058252 123058484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 123058632 123058830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 123059059 123059261 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 123059473 123060028 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 123060116 123060268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 123060593 123060798 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 123061120 123061324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1941 nt):
ATGTCCAAGGGACCTGCAGTTGGTATTGATCTTGGCACCACCTACTCTTGTGTGGGTGTTTTCCAGCACG
GA
AAAGTCGAGATAATTGCCAATGATCAGGGAAACCGAACCACTCCAAGCTATGTCGCCTTTACGGACAC
T
GAACGGTTGATCGGTGATGCCGCAAAGAATCAAGTTGCAATGAACCCCACCAACACAGTTTTTGATGCC
AAA
CGTCTGATTGGACGCAGATTTGATGATGCTGTTGTCCAGTCTGATATGAAACATTGGCCCTTTATGG
TG
GTGAATGATGCTGGCAGGCCCAAGGTCCAAGTAGAATACAAGGGAGAGACCAAAAGCTTCTATCCAGA
G
GAGGTGTCTTCTATGGTTCTGACAAAGATGAAGGAAATTGCAGAAGCCTACCTTGGGAAGACTGTTACC
AAT
GCTGTGGTCACAGTGCCAGCTTACTTTAATGACTCTCAGCGTCAGGCTACCAAAGATGCTGGAACTA
TT
GCTGGTCTCAATGTACTTAGAATTATTAATGAGCCAACTGCTGCTGCTATTGCTTACGGCTTAGACAA
A
AAGGTTGGAGCAGAAAGAAACGTGCTCATCTTTGACCTGGGAGGTGGCACTTTTGATGTGTCAATCCTC
ACT
ATTGAGGATGGAATCTTTGAGGTCAAGTCTACAGCTGGAGACACCCACTTGGGTGGAGAAGATTTTG
AC
AACCGAATGGTCAACCATTTTATTGCTGAGTTTAAGCGCAAGCATAAGAAGGACATCAGTGAGAACAA
G
AGAGCTGTAAGACGCCTCCGTACTGCTTGTGAACGTGCTAAGCGTACCCTCTCTTCCAGCACCCAGGCC
AGT
ATTGAGATCGATTCTCTCTATGAAGGAATCGACTTCTATACCTCCATTACCCGTGCCCGATTTGAAG
AA
CTGAATGCTGACCTGTTCCGTGGCACCCTGGACCCAGTAGAGAAAGCCCTTCGAGATGCCAAACTAGA
C
AAGTCACAGATTCATGATATTGTCCTGGTTGGTGGTTCTACTCGTATCCCCAAGATTCAGAAGCTTCTC
CAA
GACTTCTTCAATGGAAAAGAACTGAATAAGAGCATCAACCCTGATGAAGCTGTTGCTTATGGTGCAG
CT
GTCCAGGCAGCCATCTTGTCTGGAGACAAGTCTGAGAATGTTCAAGATTTGCTGCTCTTGGATGTCAC
T
CCTCTTTCCCTTGGTATTGAAACTGCTGGTGGAGTCATGACTGTCCTCATCAAGCGTAATACCACCATT
CCT
ACCAAGCAGACACAGACCTTCACTACCTATTCTGACAACCAGCCTGGTGTGCTTATTCAGGTTTATG
AA
GGCGAGCGTGCCATGACAAAGGATAACAACCTGCTTGGCAAGTTTGAACTCACAGGCATACCTCCTGC
A
CCCCGAGGTGTTCCTCAGATTGAAGTCACTTTTGACATTGATGCCAATGGTATACTCAATGTCTCTGCT
GTG
GACAAGAGTACGGGAAAAGAGAACAAGATTACTATCACTAATGACAAGGGCCGTTTGAGCAAGGAAG
AC
ATTGAACGTATGGTCCAGGAAGCTGAGAAGTACAAAGCTGAAGATGAGAAGCAGAGGGACAAGGTGTC
A
TCCAAGAATTCACTTGAGTCCTATGCCTTCAACATGAAAGCAACTGTTGAAGATGAGAAACTTCAAGGC
AAG
ATTAACGATGAGGACAAACAGAAGATTCTGGACAAGTGTAATGAAATTATCAACTGGCTTGATAAGA
AT
CAGACTGCTGAGAAGGAAGAATTTGAACATCAACAGAAAGAGCTGGAGAAAGTTTGCAACCCCATCAT
C
ACCAAGCTGTACCAGAGTGCAGGAGGCATGCCAGGAGGAATGCCTGGGGGATTTCCTGGTGGTGGAGCT
CCT
CCCTCTGGTGGTGCTTCCTCAGGGCCCACCATTGAAGAGGTTGATTAA


Translation (646 aa):
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDA
K
RLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGK
TVT
N
AVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK
VGAERNVLIFDLGGGTFDVSIL
T
IEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQA
S
IEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLL
Q
DFFNGKELNKSINPDEAVAYGA
AVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
P
TKQTQTFTTYSDNQPGVLIQ
VYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
V
DKSTGKENKITITNDK
GRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQG
K
INDEDKQKILDKCNEIINWLDKNQ
TAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGA
P
PSGGASSGPTIEEVD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser