NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3634.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3634.1 Public Homo sapiens 4 SNCA 17 106 76 CCDS HistoryNCBI Gene:6622Re-query CCDS DB by CCDS ID:3634.1Re-query CCDS DB by GeneID:6622See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3634.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000336904 ENSP00000338345 Accepted alive Link to Ensembl Transcript Viewer:ENST00000336904Link to Ensembl Protein Viewer:ENSP00000338345Re-query CCDS DB by Nucleotide ID:ENST00000336904Re-query CCDS DB by Protein ID:ENSP00000338345
Original member Current member EBI,WTSI ENST00000394986 ENSP00000378437 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394986Link to Ensembl Protein Viewer:ENSP00000378437Re-query CCDS DB by Nucleotide ID:ENST00000394986Re-query CCDS DB by Protein ID:ENSP00000378437
Original member Current member EBI,WTSI ENST00000394991 ENSP00000378442 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394991Link to Ensembl Protein Viewer:ENSP00000378442Re-query CCDS DB by Nucleotide ID:ENST00000394991Re-query CCDS DB by Protein ID:ENSP00000378442
Original member Current member EBI,WTSI ENST00000506244 ENSP00000422238 Accepted alive Link to Ensembl Transcript Viewer:ENST00000506244Link to Ensembl Protein Viewer:ENSP00000422238Re-query CCDS DB by Nucleotide ID:ENST00000506244Re-query CCDS DB by Protein ID:ENSP00000422238
Original member Current member EBI,WTSI ENST00000508895 ENSP00000426955 Accepted alive Link to Ensembl Transcript Viewer:ENST00000508895Link to Ensembl Protein Viewer:ENSP00000426955Re-query CCDS DB by Nucleotide ID:ENST00000508895Re-query CCDS DB by Protein ID:ENSP00000426955
Original member Current member EBI,WTSI OTTHUMT00000253547 OTTHUMP00000161559 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000253547Link to Vega Protein Viewer:OTTHUMP00000161559Re-query CCDS DB by Nucleotide ID:OTTHUMT00000253547Re-query CCDS DB by Protein ID:OTTHUMP00000161559
Original member Current member EBI,WTSI OTTHUMT00000253548 OTTHUMP00000161560 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000253548Link to Vega Protein Viewer:OTTHUMP00000161560Re-query CCDS DB by Nucleotide ID:OTTHUMT00000253548Re-query CCDS DB by Protein ID:OTTHUMP00000161560
Original member Current member EBI,WTSI OTTHUMT00000253549 OTTHUMP00000161561 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000253549Link to Vega Protein Viewer:OTTHUMP00000161561Re-query CCDS DB by Nucleotide ID:OTTHUMT00000253549Re-query CCDS DB by Protein ID:OTTHUMP00000161561
Original member Current member EBI,WTSI OTTHUMT00000361320 OTTHUMP00000218551 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000361320Link to Vega Protein Viewer:OTTHUMP00000218551Re-query CCDS DB by Nucleotide ID:OTTHUMT00000361320Re-query CCDS DB by Protein ID:OTTHUMP00000218551
Original member Current member EBI,WTSI OTTHUMT00000361322 OTTHUMP00000218553 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000361322Link to Vega Protein Viewer:OTTHUMP00000218553Re-query CCDS DB by Nucleotide ID:OTTHUMT00000361322Re-query CCDS DB by Protein ID:OTTHUMP00000218553
Original member Current member NCBI NM_000345.3 NP_000336.1 Accepted alive Link to Nucleotide Sequence:NM_000345.3Link to Protein Sequence:NP_000336.1Re-query CCDS DB by Nucleotide ID:NM_000345Re-query CCDS DB by Protein ID:NP_000336Link to BLink:NP_000336.1
Original member Current member NCBI NM_001146054.1 NP_001139526.1 Accepted alive Link to Nucleotide Sequence:NM_001146054.1Link to Protein Sequence:NP_001139526.1Re-query CCDS DB by Nucleotide ID:NM_001146054Re-query CCDS DB by Protein ID:NP_001139526Link to BLink:NP_001139526.1
Original member Current member NCBI NM_001146055.1 NP_001139527.1 Accepted alive Link to Nucleotide Sequence:NM_001146055.1Link to Protein Sequence:NP_001139527.1Re-query CCDS DB by Nucleotide ID:NM_001146055Re-query CCDS DB by Protein ID:NP_001139527Link to BLink:NP_001139527.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000336.1 140 P37840-1 140 100% 0 0
NP_001139526.1 140 P37840-1 140 100% 0 0
NP_001139527.1 140 P37840-1 140 100% 0 0

Chromosomal Locations for CCDS 3634.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 89726628 89726660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 89729194 89729277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 89822246 89822388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 89828143 89828184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 89835547 89835667 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (423 nt):
ATGGATGTATTCATGAAAGGACTTTCAAAGGCCAAGGAGGGAGTTGTGGCTGCTGCTGAGAAAACCAAAC
AG
GGTGTGGCAGAAGCAGCAGGAAAGACAAAAGAGGGTGTTCTCTATGTAGGCTCCAAAACCAAGGAGGG
A
GTGGTGCATGGTGTGGCAACAGTGGCTGAGAAGACCAAAGAGCAAGTGACAAATGTTGGAGGAGCAGTG
GTG
ACGGGTGTGACAGCAGTAGCCCAGAAGACAGTGGAGGGAGCAGGGAGCATTGCAGCAGCCACTGGCT
TT
GTCAAAAAGGACCAGTTGGGCAAGAATGAAGAAGGAGCCCCACAGGAAGGAATTCTGGAAGATATGCC
T
GTGGATCCTGACAATGAGGCTTATGAAATGCCTTCTGAGGAAGGGTATCAAGACTACGAACCTGAAGCC
TAA


Translation (140 aa):
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV
V
TGVTAVAQKTVEGAGSIAAATGFVKKDQLGK
NEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser