NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS93.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
93.1 Public Homo sapiens 1 PARK7 18 107 79 CCDS HistoryNCBI Gene:11315Re-query CCDS DB by CCDS ID:93.1Re-query CCDS DB by GeneID:11315See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 93.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000338639 ENSP00000340278 Accepted alive Link to Ensembl Transcript Viewer:ENST00000338639Link to Ensembl Protein Viewer:ENSP00000340278Re-query CCDS DB by Nucleotide ID:ENST00000338639Re-query CCDS DB by Protein ID:ENSP00000340278
Original member Current member EBI,WTSI ENST00000377488 ENSP00000366708 Accepted alive Link to Ensembl Transcript Viewer:ENST00000377488Link to Ensembl Protein Viewer:ENSP00000366708Re-query CCDS DB by Nucleotide ID:ENST00000377488Re-query CCDS DB by Protein ID:ENSP00000366708
Original member Current member EBI,WTSI ENST00000377491 ENSP00000366711 Accepted alive Link to Ensembl Transcript Viewer:ENST00000377491Link to Ensembl Protein Viewer:ENSP00000366711Re-query CCDS DB by Nucleotide ID:ENST00000377491Re-query CCDS DB by Protein ID:ENSP00000366711
Original member Current member EBI,WTSI ENST00000493678 ENSP00000418770 Accepted alive Link to Ensembl Transcript Viewer:ENST00000493678Link to Ensembl Protein Viewer:ENSP00000418770Re-query CCDS DB by Nucleotide ID:ENST00000493678Re-query CCDS DB by Protein ID:ENSP00000418770
Original member Current member EBI,WTSI OTTHUMT00000003577 OTTHUMP00000001348 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000003577Link to Vega Protein Viewer:OTTHUMP00000001348Re-query CCDS DB by Nucleotide ID:OTTHUMT00000003577Re-query CCDS DB by Protein ID:OTTHUMP00000001348
Original member Current member EBI,WTSI OTTHUMT00000003578 OTTHUMP00000001349 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000003578Link to Vega Protein Viewer:OTTHUMP00000001349Re-query CCDS DB by Nucleotide ID:OTTHUMT00000003578Re-query CCDS DB by Protein ID:OTTHUMP00000001349
Original member Current member EBI,WTSI OTTHUMT00000003581 OTTHUMP00000001350 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000003581Link to Vega Protein Viewer:OTTHUMP00000001350Re-query CCDS DB by Nucleotide ID:OTTHUMT00000003581Re-query CCDS DB by Protein ID:OTTHUMP00000001350
Original member Current member EBI,WTSI OTTHUMT00000003582 OTTHUMP00000001351 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000003582Link to Vega Protein Viewer:OTTHUMP00000001351Re-query CCDS DB by Nucleotide ID:OTTHUMT00000003582Re-query CCDS DB by Protein ID:OTTHUMP00000001351
Original member Current member NCBI NM_001123377.1 NP_001116849.1 Accepted alive Link to Nucleotide Sequence:NM_001123377.1Link to Protein Sequence:NP_001116849.1Re-query CCDS DB by Nucleotide ID:NM_001123377Re-query CCDS DB by Protein ID:NP_001116849Link to BLink:NP_001116849.1
Original member Current member NCBI NM_007262.4 NP_009193.2 Accepted alive Link to Nucleotide Sequence:NM_007262.4Link to Protein Sequence:NP_009193.2Re-query CCDS DB by Nucleotide ID:NM_007262Re-query CCDS DB by Protein ID:NP_009193Link to BLink:NP_009193.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001116849.1 189 Q99497 189 100% 0 0
NP_009193.2 189 Q99497 189 100% 0 0

Chromosomal Locations for CCDS 93.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 7962786 7962875 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 7965324 7965425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 7969345 7969404 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 7970894 7970963 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 7977652 7977738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 7984894 7985054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (570 nt):
ATGGCTTCCAAAAGAGCTCTGGTCATCCTGGCTAAAGGAGCAGAGGAAATGGAGACGGTCATCCCTGTAG
AT
GTCATGAGGCGAGCTGGGATTAAGGTCACCGTTGCAGGCCTGGCTGGAAAAGACCCAGTACAGTGTAG
C
CGTGATGTGGTCATTTGTCCTGATGCCAGCCTTGAAGATGCAAAAAAAGAGGGACCATATGATGTGGTG
GTT
CTACCAGGAGGTAATCTGGGCGCACAGAATTTATCTGAGTCTGCTGCTGTGAAGGAGATACTGAAGG
AG
CAGGAAAACCGGAAGGGCCTGATAGCCGCCATCTGTGCAGGTCCTACTGCTCTGTTGGCTCATGAAAT
A
GGTTTTGGAAGTAAAGTTACAACACACCCTCTTGCTAAAGACAAAATGATGAATGGAGGTCATTACACC
TAC
TCTGAGAATCGTGTGGAAAAAGACGGCCTGATTCTTACAAGCCGGGGGCCTGGGACCAGCTTCGAGT
TT
GCGCTTGCAATTGTTGAAGCCCTGAATGGCAAGGAGGTGGCGGCTCAAGTGAAGGCTCCACTTGTTCT
T
AAAGACTAG


Translation (189 aa):
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVV
V
LPGGNLGAQNLSE
SAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYT
Y
SENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser