NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6733.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6733.1 Public Homo sapiens 9 NANS 18 107 79 CCDS HistoryNCBI Gene:54187Re-query CCDS DB by CCDS ID:6733.1Re-query CCDS DB by GeneID:54187See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 6733.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000210444 ENSP00000210444 Accepted alive Link to Ensembl Transcript Viewer:ENST00000210444Link to Ensembl Protein Viewer:ENSP00000210444Re-query CCDS DB by Nucleotide ID:ENST00000210444Re-query CCDS DB by Protein ID:ENSP00000210444
Original member Current member EBI,WTSI OTTHUMT00000053359 OTTHUMP00000021769 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000053359Link to Vega Protein Viewer:OTTHUMP00000021769Re-query CCDS DB by Nucleotide ID:OTTHUMT00000053359Re-query CCDS DB by Protein ID:OTTHUMP00000021769
Original member Current member NCBI NM_018946.3 NP_061819.2 Accepted alive Link to Nucleotide Sequence:NM_018946.3Link to Protein Sequence:NP_061819.2Re-query CCDS DB by Nucleotide ID:NM_018946Re-query CCDS DB by Protein ID:NP_061819Link to BLink:NP_061819.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061819.2 359 Q9NR45 359 100% 0 0

Chromosomal Locations for CCDS 6733.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 98056809 98056940 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98060782 98060997 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98076918 98077017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98078193 98078347 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98080816 98081082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 98082846 98083055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGCCGCTGGAGCTGGAGCTGTGTCCCGGGCGCTGGGTGGGCGGGCAACACCCGTGCTTCATCATTGCCG
AG
ATCGGCCAGAACCACCAGGGCGACCTGGACGTAGCCAAGCGCATGATCCGCATGGCCAAGGAGTGTGG
G
GCTGATTGTGCTAAGTTCCAGAAGAGTGAGCTAGAATTCAAGTTTAATCGGAAAGCCTTGGAGAGGCCA
TAC
ACCTCGAAGCATTCCTGGGGGAAGACGTACGGGGAGCACAAACGACATCTGGAGTTCAGCCATGACC
AG
TACAGGGAGCTGCAGAGGTACGCCGAGGAGGTTGGGATCTTCTTCACTGCCTCTGGCATGGATGAGAT
G
GCAGTTGAATTCCTGCATGAACTGAATGTTCCATTTTTCAAAGTTGGATCTGGAGACACTAATAATTTT
CCT
TATCTGGAAAAGACAGCCAAAAAAGGTCGCCCAATGGTGATCTCCAGTGGGATGCAGTCAATGGACA
CC
ATGAAGCAAGTTTATCAGATCGTGAAGCCCCTCAACCCCAACTTCTGCTTCTTGCAGTGTACCAGCGC
A
TACCCGCTCCAGCCTGAGGACGTCAACCTGCGGGTCATCTCGGAATATCAGAAGCTCTTTCCTGACATT
CCC
ATAGGGTATTCTGGGCATGAAACAGGCATAGCGATATCTGTGGCCGCAGTGGCTCTGGGGGCCAAGG
TG
TTGGAACGTCACATAACTTTGGACAAGACCTGGAAGGGGAGTGACCACTCGGCCTCGCTGGAGCCTGG
A
GAACTGGCCGAGCTGGTGCGGTCAGTGCGTCTTGTGGAGCGTGCCCTGGGCTCCCCAACCAAGCAGCTG
CTG
CCCTGTGAGATGGCCTGCAATGAGAAGCTGGGCAAGTCTGTGGTGGCCAAAGTGAAAATTCCGGAAG
GC
ACCATTCTAACAATGGACATGCTCACCGTGAAGGTGGGTGAGCCCAAAGGCTATCCTCCTGAAGACAT
C
TTTAATCTAGTGGGCAAGAAGGTCCTGGTCACTGTTGAAGAGGATGACACCATCATGGAAGAATTGGTA
GAT
AATCATGGCAAAAAAATCAAGTCTTAA


Translation (359 aa):
MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERP
Y
TSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDE
MAVEFLHELNVPFFKVGSGDTNNF
P
YLEKTAKK
GRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDI
P
IGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL
L
PCEMACNEK
LGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELV
D
NHGKKIKS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser