NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS44734.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44734.1 Public Homo sapiens 11 ANKK1 17 106 76 CCDS HistoryNCBI Gene:255239Re-query CCDS DB by CCDS ID:44734.1Re-query CCDS DB by GeneID:255239See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Sequence IDs included in CCDS 44734.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000303941 ENSP00000306678 Accepted alive Link to Ensembl Transcript Viewer:ENST00000303941Link to Ensembl Protein Viewer:ENSP00000306678Re-query CCDS DB by Nucleotide ID:ENST00000303941Re-query CCDS DB by Protein ID:ENSP00000306678
Original member Current member EBI,WTSI OTTHUMT00000395830 OTTHUMP00000236610 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000395830Link to Vega Protein Viewer:OTTHUMP00000236610Re-query CCDS DB by Nucleotide ID:OTTHUMT00000395830Re-query CCDS DB by Protein ID:OTTHUMP00000236610
Original member Current member NCBI NM_178510.1 NP_848605.1 Accepted alive Link to Nucleotide Sequence:NM_178510.1Link to Protein Sequence:NP_848605.1Re-query CCDS DB by Nucleotide ID:NM_178510Re-query CCDS DB by Protein ID:NP_848605Link to BLink:NP_848605.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848605.1 765 Q8NFD2 765 100% 0 0

Chromosomal Locations for CCDS 44734.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 113387885 113388069 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 113393481 113393775 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 113394929 113395080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 113395359 113395408 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 113396067 113396222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 113397224 113397342 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 113397980 113398016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 113398964 113400267 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2298 nt):
ATGGCTGCCGACCCCACCGAGCTGCGGCTGGGCAGCCTCCCCGTCTTCACCCGCGACGACTTCGAGGGCG
AC
TGGCGCCTAGTGGCCAGCGGCGGCTTCAGCCAGGTGTTCCAGGCGCGGCACAGGCGCTGGCGGACGGA
G
TACGCCATCAAGTGCGCCCCCTGCCTTCCACCCGACGCCGCCAGCTCTGATGTGAATTACCTCATTGAA
GAA
GCTGCCAAAATGAAGAAGATCAAGTTTCAGCACATCGTGTCTATCTACGGGGTGTGCAAGCAGCCCC
TG
GGTATTGTGATGGAGTTTATGGCCAACGGCTCCCTGGAGAAGGTGCTGTCCACCCACAGCCTCTGCTG
G
AAGCTCAGGTTCCGCATCATCCATGAGACCAGCTTGGCCATGAACTTCCTGCACAGCATTAAGCCGCCT
CTG
CTCCACCTGGACCTCAAGCCGGGCAACATACTCCTGGACAGCAACATGCATGTCAAAATTTCAGACT
TC
GGCCTGTCCAAGTGGATGGAACAGTCCACCCGGATGCAGTACATCGAGAGGTCGGCTCTGCGGGGCAT
G
CTCAGCTACATCCCCCCTGAGATGTTCCTGGAGAGTAACAAGGCCCCAGGACCTAAATATGATGTGTAC
AG
C
TTTGCAATTGTCATCTGGGAGCTACTCACTCAGAAGAAACCATACTCAGGGTTCAACATGATGATGA
TT
ATTATCCGAGTGGCGGCAGGCATGCGGCCCTCCCTACAGCCTGTCTCTGACCAATGGCCAAGCGAGGC
C
CAGCAGATGGTGGACCTGATGAAACGCTGCTGGGACCAGGACCCCAAGAAGAGGCCATGCTTTCTAGAC
ATT
ACCATCGAGACAGACATACTGCTGTCACTGCTGCAGAGTCGTGTGGCAGTCCCAGAGAGCAAGGCCC
TG
GCCAGGAAGGTGTCCTGCAAGCTGTCGCTGCGCCAGCCCGGGGAGGTTAATGAGGACATCAGCCAGGA
A
CTGATGGACAGTGACTCAGGAAACTACCTGAAGCGGGCCCTTCAGCTCTCCGACCGTAAGAATTTGGTC
CCG
AGAGATGAGGAACTGTGTATCTATGAGAACAAGGTCACCCCCCTCCACTTCCTGGTGGCCCAGGGCA
GT
GTGGAGCAGGTGAGGTTGCTGCTGGCCCACGAGGTAGACGTGGACTGCCAGACGGCCTCTGGATACAC
G
CCCCTCCTGATCGCCGCCCAGGACCAGCAACCCGACCTCTGTGCCCTGCTTTTGGCACATGGTGCTGAT
GCC
AACCGAGTGGATGAGGATGGCTGGGCCCCACTGCACTTTGCAGCCCAGAATGGGGATGACGGCACTG
CG
CGCCTGCTCCTGGACCACGGGGCCTGTGTGGATGCCCAGGAACGTGAAGGGTGGACCCCTCTTCACCT
G
GCTGCACAGAATAACTTTGAGAATGTGGCACGGCTTCTGGTCTCCCGTCAGGCTGACCCCAACCTGCAT
GAG
GCTGAGGGCAAGACCCCCCTCCATGTGGCCGCCTACTTTGGCCATGTTAGCCTGGTCAAGCTGCTGA
CC
AGCCAGGGGGCTGAGTTGGATGCTCAGCAGAGAAACCTGAGAACACCACTGCACCTGGCAGTAGAGCG
G
GGCAAAGTGAGGGCCATCCAACACCTGCTGAAGAGTGGAGCGGTCCCTGATGCCCTTGACCAGAGCGGC
TAC
GGCCCACTGCACACTGCAGCTGCCAGGGGCAAATACCTGATCTGCAAGATGCTGCTCAGGTACGGAG
CC
AGCCTTGAGCTGCCCACCCACCAGGGCTGGACACCCCTGCATCTAGCAGCCTACAAGGGCCACCTGGA
G
ATCATCCATCTGCTGGCAGAGAGCCACGCAAACATGGGTGCTCTTGGAGCTGTGAACTGGACTCCCCTG
CAC
CTAGCTGCACGCCACGGGGAGGAGGCGGTGGTGTCAGCACTGCTGCAGTGTGGGGCTGACCCCAATG
CT
GCAGAGCAGTCAGGCTGGACACCCCTCCACCTGGCGGTCCAGAGGAGCACCTTCCTGAGTGTCATCAA
C
CTCCTAGAACATCACGCAAATGTCCACGCCCGCAACAAGGTGGGCTGGACACCCGCCCACCTGGCCGCC
CTC
AAGGGCAACACAGCCATCCTCAAAGTGCTGGTCGAGGCAGGCGCCCAGCTGGACGTCCAGGATGGAG
TG
AGCTGCACACCCCTGCAACTGGCCCTCCGCAGCCGAAAGCAGGGCATCATGTCCTTCCTAGAGGGCAA
G
GAGCCGTCAGTGGCCACTCTGGGTGGTTCTAAGCCAGGAGCCGAGATGGAAATTTAG


Translation (765 aa):
MAADPTELRLGSLPVFTRDDFEGDWRLVASGGFSQVFQARHRRWRTEYAIKCAPCLPPDAASSDVNYLIE
E
AAKMKKIKFQHIVSIYGVCKQPLGIVMEFMANGSLEKVLSTHSLCWKLRFRIIHETSLAMNFLHSIKPP
L
LHLDLKPGNILLDSNMHVK
ISDFGLSKWMEQSTRMQYIERSALRGMLSYIPPEMFLESNKAPGPKYDVY
S
FAIVIWELLTQKKPYSGFNMMMIIIRVAAGMRPSLQPVSDQWPSEAQQMVDLMKRCWDQDPKKRPCFLD
I
TIETDILLSLLQSRVAVPESKALARKVSCKLSLRQPGE
VNEDISQELMDSDSGNYLKRALQLSDRKNLV
P
RDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGAD
A
NRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLH
E
AEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSG
Y
GPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPL
H
LAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAA
L
KGNTAILKVLVEAGAQLDVQDGVSCTPLQLALRSRKQGIMSFLEGKEPSVATLGGSKPGAEMEI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser