NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11439.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11439.1 Public Homo sapiens 17 WNK4 17 106 76 CCDS HistoryNCBI Gene:65266Re-query CCDS DB by CCDS ID:11439.1Re-query CCDS DB by GeneID:65266See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 11439.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000246914 ENSP00000246914 Accepted alive Link to Ensembl Transcript Viewer:ENST00000246914Link to Ensembl Protein Viewer:ENSP00000246914Re-query CCDS DB by Nucleotide ID:ENST00000246914Re-query CCDS DB by Protein ID:ENSP00000246914
Original member Current member EBI,WTSI OTTHUMT00000452389 OTTHUMP00000264871 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000452389Link to Vega Protein Viewer:OTTHUMP00000264871Re-query CCDS DB by Nucleotide ID:OTTHUMT00000452389Re-query CCDS DB by Protein ID:OTTHUMP00000264871
Original member Current member NCBI NM_032387.4 NP_115763.2 Accepted alive Link to Nucleotide Sequence:NM_032387.4Link to Protein Sequence:NP_115763.2Re-query CCDS DB by Nucleotide ID:NM_032387Re-query CCDS DB by Protein ID:NP_115763Link to BLink:NP_115763.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_115763.2 1243 Q96J92-1 1243 100% 0 0

Chromosomal Locations for CCDS 11439.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 42780699 42781316 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42782758 42782930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42783937 42784157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42784422 42784579 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42785097 42785185 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42785266 42785482 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42787278 42787542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42787778 42787899 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42788130 42788188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42788290 42788407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42788681 42788797 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42793592 42793729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42794614 42794668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42794772 42795382 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42795461 42795521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42795625 42796033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42796123 42796322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42796481 42796578 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 42796686 42796688 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3732 nt):
ATGTTGGCATCCCCGGCCACGGAGACCACCGTCCTCATGTCCCAGACTGAGGCCGACCTGGCCCTGCGGC
CC
CCGCCTCCTCTTGGCACCGCGGGGCAGCCCCGCCTCGGGCCCCCTCCTCGCCGAGCGCGCCGCTTCTC
C
GGGAAGGCTGAGCCCCGGCCGCGCTCTTCTCGTCTCAGCCGCCGTAGCTCAGTCGACTTGGGGCTGCTG
AGC
TCTTGGTCCCTGCCAGCCTCACCCGCTCCGGACCCCCCCGATCCTCCGGACTCCGCTGGTCCTGGCC
CC
GCGAGGAGCCCACCGCCTAGCTCCAAAGAACCCCCCGAGGGCACGTGGACCGAGGGAGCCCCTGTGAA
G
GCTGCGGAAGACTCCGCGCGTCCCGAGCTCCCGGACTCTGCAGTGGGCCCGGGGTCCAGGGAGCCGCTA
AGG
GTCCCTGAAGCTGTGGCCCTAGAGCGGCGGCGGGAGCAGGAAGAAAAGGAGGACATGGAGACCCAGG
CT
GTGGCAACGTCCCCCGATGGCCGATACCTCAAGTTTGACATCGAGATTGGACGTGGCTCCTTCAAGAC
G
GTGTATCGAGGGCTAGACACCGACACCACAGTGGAGGTGGCCTGGTGTGAGCTGCAGACTCGGAAACTG
TCT
AGAGCTGAGCGGCAGCGCTTCTCAGAGGAGGTGGAGATGCTCAAGGGGCTGCAGCACCCCAACATCG
TC
CGCTTCTATGATTCGTGGAAGTCGGTGCTGAGGGGCCAGGTTTGCATCGTGCTGGTCACCGAACTCAT
G
ACCTCGGGCACGCTCAAGACGTACCTGAGGCGGTTCCGGGAGATGAAGCCGCGGGTCCTTCAGCGCTGG
AGC
CGCCAAATCCTGCGGGGACTTCATTTCCTACACTCCCGGGTTCCTCCCATCCTGCACCGGGATCTCA
AG
TGCGACAATGTCTTTATCACGGGACCTACTGGCTCTGTCAAAATCGGGGACCTGGGCCTGGCCACGCT
C
AAGCGCGCCTCCTTTGCCAAGAGTGTCATCGGGACCCCGGAATTCATGGCCCCCGAGATGTACGAGGAA
AAG
TACGATGAGGCCGTGGACGTGTACGCGTTCGGCATGTGCATGCTGGAGATGGCCACCTCTGAGTACC
CG
TACTCCGAGTGCCAGAATGCCGCGCAAATCTACCGCAAGGTCACTTCGGGCAGAAAGCCGAACAGCTT
C
CACAAGGTGAAGATACCCGAGGTGAAGGAGATCATTGAAGGCTGCATCCGCACGGATAAGAACGAGAGG
TTC
ACCATCCAGGACCTCCTGGCCCACGCCTTCTTCCGCGAGGAGCGCGGTGTGCACGTGGAACTAGCGG
AG
GAGGACGACGGCGAGAAGCCGGGCCTCAAGCTCTGGCTGCGCATGGAGGACGCGCGGCGCGGGGGGCG
C
CCACGGGACAACCAGGCCATCGAGTTCCTGTTCCAGCTGGGCCGGGACGCGGCCGAGGAGGTGGCACAG
GAG
ATGGTGGCTCTGGGCTTGGTCTGTGAAGCCGATTACCAGCCAGTGGCCCGTGCAGTACGTGAACGGG
TT
GCTGCCATCCAGCGAAAGCGTGAGAAGCTGCGTAAAGCAAGGGAATTGGAGGCACTCCCACCAGAGCC
A
GGACCTCCACCAGCAACTGTGCCCATGGCCCCCGGTCCCCCCAGTGTCTTCCCCCCTGAGCCTGAGGAG
CCA
GAGGCAGACCAGCACCAGCCCTTCCTTTTCCGCCACGCCAGCTACTCATCTACCACTTCGGATTGCG
AG
ACTGATGGCTACCTCAGCTCCTCCGGCTTCCTGGATGCCTCAGACCCTGCCCTTCAGCCCCCTGGGGG
G
GTGCCATCCAGCCTGGCTGAGTCCCATCTCTGCCTGCCCTCGGCTTTTGCCCTATCCATTCCACGTTCT
GGC
CCTGGAAGTGACTTTTCCCCCGGGGACAGCTATGCCTCAGATGCAGCTTCAGGCCTTAGCGATGTGG
GA
GAAGGGATGGGACAAATGAGGAGACCCCCAGGGAGGAATCTCCGGCGCAGACCCCGATCCCGGCTGCG
G
GTCACTAGTGTCTCAGACCAGAATGACAGAGTGGTTGAGTGCCAGCTACAGACCCATAACAGCAAGATG
GTG
ACCTTCCGATTTGATCTGGATGGGGACAGCCCGGAAGAGATTGCAGCTGCCATGGTATATAACGAGT
TC
ATTCTGCCTTCGGAGCGAGATGGATTTCTCAGACGGATTCGGGAGATTATCCAGCGAGTGGAGACCCT
G
TTGAAGAGAGACACTGGCCCCATGGAGGCTGCTGAAGACACCCTAAGCCCCCAGGAGGAGCCAGCACCA
TTA
CCTGCCCTGCCCGTCCCCCTCCCAGACCCATCCAATGAAGAGCTCCAGAGCAGCACCTCCCTGGAGC
AC
AGGAGCTGGACAGCCTTCTCCACCTCCTCATCTTCTCCTGGAACTCCTTTGTCTCCTGGAAACCCATT
T
TCCCCTGGAACCCCCATTTCCCCAGGTCCCATCTTCCCCATCACTTCTCCCCCATGTCATCCCAGCCCC
TCC
CCATTCTCCCCCATTTCTTCCCAGGTCTCCTCAAATCCCTCTCCACACCCCACCAGCTCTCCACTTC
CA
TTCTCCTCCAGCACACCCGAGTTTCCGGTCCCACTCTCTCAGTGTCCCTGGAGTTCTCTCCCCACGAC
T
TCTCCACCTACGTTCTCTCCCACTTGTTCTCAGGTCACTCTTAGTTCCCCTTTCTTTCCTCCGTGCCCC
TCC
ACTTCTTCCTTCCCCTCCACCACAGCAGCCCCTCTCCTTTCTCTGGCTAGTGCCTTCTCACTGGCTG
TG
ATGACTGTGGCCCAGTCCCTGCTGTCCCCCTCACCTGGGCTCCTTTCCCAGTCTCCTCCAGCCCCTCC
T
AGTCCCCTCCCTAGCCTGCCCCTTCCCCCTCCCGTTGCTCCTGGTGGCCAGGAAAGCCCTTCACCCCAC
ACA
GCTGAGGTGGAGAGTGAGGCCTCACCACCTCCTGCTCGGCCCCTCCCAGGGGAAGCCAGGCTGGCGC
CC
ATCTCTGAAGAGGGAAAGCCGCAGCTTGTTGGGCGTTTCCAAGTGACTTCATCCAAGGAACCGGCTGA
G
CCTCTTCCCTTGCAGCCAACATCCCCCACTCTCTCTGGTTCTCCAAAACCTTCAACCCCTCAGCTCACT
TCA
GAGAGCTCAGATACAGAGGACAGTGCTGGAGGCGGGCCAGAGACCAGGGAAGCTCTGGCTGAGAGCG
AC
CGTGCAGCTGAGGGTCTGGGGGCTGGAGTTGAGGAGGAAGGAGATGATGGGAAGGAACCCCAAGTTGG
G
GGCAGCCCCCAACCCCTGAGCCATCCCAGCCCAGTGTGGATGAACTACTCCTACAGCAGCCTGTGTTTG
AGC
AGCGAGGAGTCAGAAAGCAGTGGGGAAGATGAGGAGTTCTGGGCTGAGCTGCAGAGTCTTCGGCAGA
A
G
CACTTGTCAGAGGTGGAAACACTACAGACACTACAGAAAAAAGAAATTGAAGATTTGTACAGCCGGCT
G
GGGAAGCAGCCCCCACCGGGTATTGTGGCCCCAGCTGCTATGCTGTCCAGCCGCCAGCGCCGCCTCTCC
AAG
GGCAGCTTCCCCACCTCCCGCCGCAACAGCCTACAGCGCTCTGAGCCCCCAGGCCCTGGCATCATGC
GA
AGGAACTCTCTGAGTGGCAGCAGCACCGGCTCCCAGGAGCAGCGGGCAAGCAAGGGGGTGACATTCGC
C
GGGGATGTTGGCAGGATGTGA


Translation (1243 aa):
MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLSRRSSVDLGLL
S
SWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAEDSARPELPDSAVGPGSREPL
R
VPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEIGRGSFKTVYRGLDTDTTVEVAWCELQ
TRKL
S
RAERQRFSEEVEMLKGLQHPNIVRFYDSWKSVLRGQVCIVLVTELMTSGTLK
TYLRRFREMKPRVLQRW
S
RQILRGLHFLHSRVPPILHRDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVI
GTPEFMAPEMYEE
K
YDEAVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTS
GRKPNSFHKVKIPEVKEIIEGCIRTDKNER
F
TIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQLGRDAAEEVAQ
E
M
VALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPPPATVPMAPGPPSVFPPEPEE
P
EADQHQPFLFRHASYSSTT
SDCETDGYLSSSGFLDASDPALQPPGGVPSSLAESHLCLPSAFALSIPRS
G
PGSDFSPGD
SYASDAASGLSDVGEGMGQMRRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKM
V
TFRFDLDGDSPEEIAAAM
VYNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAP
L
PALPVPLPDPSN
EELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP
S
PFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVTLSSPFFPPCP
S
TSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPLPSLPLPPPVAPGGQESPSPH
T
AEVESE
ASPPPARPLPGEARLAPISEEGKPQLVGRFQVTSSKEPAEPLPLQPTSPTLSGSPKPSTPQLT
S
ESSDTEDSAGGGPETREALAESDRAAEGLGAGVEEEGDDGKEPQVGGSPQPLSHPSPVWMNYSYSSLCL
S
SEESESSGEDEEFWAELQSLRQ
KHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLS
K
GSFPTSRRNSLQRSEPPGP
GIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser