NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9327.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9327.1 Public Homo sapiens 13 PDX1 17 106 76 CCDS HistoryNCBI Gene:3651Re-query CCDS DB by CCDS ID:9327.1Re-query CCDS DB by GeneID:3651

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 9327.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000381033 ENSP00000370421 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381033Link to Ensembl Protein Viewer:ENSP00000370421Re-query CCDS DB by Nucleotide ID:ENST00000381033Re-query CCDS DB by Protein ID:ENSP00000370421
Original member Current member EBI,WTSI OTTHUMT00000044310 OTTHUMP00000018174 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000044310Link to Vega Protein Viewer:OTTHUMP00000018174Re-query CCDS DB by Nucleotide ID:OTTHUMT00000044310Re-query CCDS DB by Protein ID:OTTHUMP00000018174
Original member Current member NCBI NM_000209.3 NP_000200.1 Accepted alive Link to Nucleotide Sequence:NM_000209.3Link to Protein Sequence:NP_000200.1Re-query CCDS DB by Nucleotide ID:NM_000209Re-query CCDS DB by Protein ID:NP_000200Link to BLink:NP_000200.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000200.1 283 P52945 283 100% 0 0

Chromosomal Locations for CCDS 9327.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

Chromosome Start Stop Links
13 27920139 27920544 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 27924256 27924701 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (852 nt):
ATGAACGGCGAGGAGCAGTACTACGCGGCCACGCAGCTTTACAAGGACCCATGCGCGTTCCAGCGAGGCC
CG
GCGCCGGAGTTCAGCGCCAGCCCCCCTGCGTGCCTGTACATGGGCCGCCAGCCCCCGCCGCCGCCGCC
G
CACCCGTTCCCTGGCGCCCTGGGCGCGCTGGAGCAGGGCAGCCCCCCGGACATCTCCCCGTACGAGGTG
CCC
CCCCTCGCCGACGACCCCGCGGTGGCGCACCTTCACCACCACCTCCCGGCTCAGCTCGCGCTCCCCC
AC
CCGCCCGCCGGGCCCTTCCCGGAGGGAGCCGAGCCGGGCGTCCTGGAGGAGCCCAACCGCGTCCAGCT
G
CCTTTCCCATGGATGAAGTCTACCAAAGCTCACGCGTGGAAAGGCCAGTGGGCAGGCGGCGCCTACGCT
GCG
GAGCCGGAGGAGAACAAGCGGACGCGCACGGCCTACACGCGCGCACAGCTGCTAGAGCTGGAGAAGG
AG
TTCCTATTCAACAAGTACATCTCACGGCCGCGCCGGGTGGAGCTGGCTGTCATGTTGAACTTGACCGA
G
AGACACATCAAGATCTGGTTCCAAAACCGCCGCATGAAGTGGAAAAAGGAGGAGGACAAGAAGCGCGGC
GGC
GGGACAGCTGTCGGGGGTGGCGGGGTCGCGGAGCCTGAGCAGGACTGCGCCGTGACCTCCGGCGAGG
AG
CTTCTGGCGCTGCCGCCGCCGCCGCCCCCCGGAGGTGCTGTGCCGCCCGCTGCCCCCGTTGCCGCCCG
A
GAGGGCCGCCTGCCGCCTGGCCTTAGCGCGTCGCCACAGCCCTCCAGCGTCGCGCCTCGGCGGCCGCAG
GAA
CCACGATGA


Translation (283 aa):
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEV
P
PLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWA
GGAYA
A
EPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRG
G
GTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ
E
PR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser