NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8680.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8680.1 Public Homo sapiens 12 PLCZ1 17 106 76 CCDS HistoryNCBI Gene:89869Re-query CCDS DB by CCDS ID:8680.1See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 8680.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000266505 ENSP00000266505 Accepted alive Link to Ensembl Transcript Viewer:ENST00000266505Link to Ensembl Protein Viewer:ENSP00000266505Re-query CCDS DB by Nucleotide ID:ENST00000266505Re-query CCDS DB by Protein ID:ENSP00000266505
Original member Current member EBI,WTSI OTTHUMT00000401667 OTTHUMP00000239780 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000401667Link to Vega Protein Viewer:OTTHUMP00000239780Re-query CCDS DB by Nucleotide ID:OTTHUMT00000401667Re-query CCDS DB by Protein ID:OTTHUMP00000239780
Original member Current member NCBI NM_033123.3 NP_149114.2 Accepted alive Link to Nucleotide Sequence:NM_033123.3Link to Protein Sequence:NP_149114.2Re-query CCDS DB by Nucleotide ID:NM_033123Re-query CCDS DB by Protein ID:NP_149114Link to BLink:NP_149114.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_149114.2 608 Q86YW0-1 608 100% 0 0

Chromosomal Locations for CCDS 8680.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 18683239 18683324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18684130 18684279 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18688089 18688218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18694910 18695079 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18696150 18696266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18699794 18699950 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18701501 18701568 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18701692 18701776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18705166 18705315 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18712842 18712986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18719431 18719632 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18723311 18723542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18736221 18736344 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 18737361 18737371 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1827 nt):
ATGGAAATGAGATGGTTTTTGTCAAAGATTCAGGATGACTTCAGAGGTGGAAAAATTAACCTAGAAAAAA
CT
CAGAGGTTACTTGAAAAATTAGATATTCGGTGCAGTTATATTCATGTGAAACAGATTTTTAAGGACAA
T
GACAGGCTGAAACAAGGAAGAATCACCATAGAAGAATTTAGAGCAATTTATCGAATTATCACGCACAGA
GAA
GAAATTATTGAGATTTTCAACACATATTCTGAAAACCGGAAAATTCTTTTAGCAAGTAATCTGGCTC
AA
TTTCTGACACAAGAACAATATGCAGCTGAGATGAGTAAAGCTATTGCTTTTGAGATCATTCAGAAATA
C
GAGCCTATCGAAGAAGTTAGGAAAGCACACCAAATGTCATTAGAAGGTTTTACAAGATACATGGATTCA
CGT
GAATGTCTACTGTTTAAAAATGAATGTAGAAAAGTTTATCAAGATATGACTCATCCATTAAATGATT
AT
TTTATTTCATCTTCACATAACACATATTTGGTATCTGATCAATTATTGGGACCAAGTGACCTTTGGGG
A
TATGTAAGTGCCCTTGTGAAAGGATGCCGTTGTTTGGAGATTGACTGCTGGGATGGAGCACAAAATGAA
CCT
GTTGTATATCATGGCTACACACTCACAAGCAAACTTCTGTTTAAAACTGTTATCCAAGCTATACACA
AG
TATGCATTCATGACATCTGACTACCCAGTGGTGCTCTCTTTAGAAAATCACTGCTCCACTGCCCAACA
A
GAAGTAATGGCAGACAATTTGCAGGCTACTTTTGGAGAGTCCTTGCTTTCTGATATGCTTGATGATTTT
CCT
GATACTCTACCATCACCAGAGGCACTAAAATTCAAAATATTAGTTAAAAATAAGAAAATAGGAACCT
TA
AAGGAAACCCATGAAAGAAAAGGTTCTGATAAGCGTGGAGACAATCAAGACAAGGAAACAGGGGTAAA
A
AAGTTACCTGGAGTAATGCTTTTCAAGAAAAAGAAGACCAGGAAGCTAAAAATTGCTCTGGCCTTATCT
GAT
CTTGTCATTTATACGAAAGCTGAGAAATTCAAAAGCTTTCAACATTCAAGATTATATCAGCAATTTA
AT
GAAAATAATTCTATTGGGGAGACACAAGCCCGAAAACTTTCAAAATTGCGAGTCCATGAGTTTATTTT
T
CACACCAGGAAGTTCATTACCAGAATATATCCCAAAGCAACAAGAGCAGACTCTTCTAATTTTAATCCC
CAA
GAATTTTGGAATATAGGTTGTCAAATGGTGGCTTTAAATTTCCAGACCCCTGGTCTGCCCATGGATC
TG
CAAAATGGGAAATTTTTGGATAATGGTGGTTCTGGATATATTTTGAAACCACATTTCTTAAGAGAGAG
T
AAATCATACTTTAACCCAAGTAACATAAAAGAGGGTATGCCAATTACACTTACAATAAGGCTCATCAGT
GGT
ATCCAGTTGCCTCTTACTCATTCATCATCTAACAAAGGTGATTCATTAGTAATTATAGAAGTTTTTG
GT
GTTCCAAATGATCAAATGAAGCAGCAGACTCGTGTAATTAAAAAAAATGCTTTTAGTCCAAGATGGAA
T
GAAACATTCACATTTATTATTCATGTCCCAGAATTGGCATTGATACGTTTTGTTGTTGAAGGTCAAGGT
TTA
ATAGCAGGAAATGAATTTCTTGGGCAATATACTTTGCCACTTCTATGCATGAACAAAGGTTATCGTC
GT
ATTCCTCTGTTTTCCAGAATGGGTGAGAGCCTTGAGCCTGCTTCACTGTTTGTTTATGTTTGGTACGT
C
AGATAA


Translation (608 aa):
MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEFRAIYRIITHR
E
EIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPIEE
VRKAHQMSLEGFTRYMDS
R
ECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLLGPSDLWGYV
SALVKGCRCLEIDCWDGAQNE
P
VVYHGYTLTSKLLFKTVIQAIHKYAFM
TSDYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDF
P
DTLPSPE
ALKFKILVKNKKIGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALS
D
LVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARKLSKLR
VHEFIFHTRKFITRIYPKATRADSSNFNP
Q
EFWNIGCQM
VALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGMPITLTIRLIS
G
IQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKN
AFSPRWNETFTFIIHVPELALIRFVVEGQG
L
IAGNEFLGQYTLPLLCMNK
GYRRIPLFSRMGESLEPASLFVYVWYVR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser