NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5225.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5225.1 Public Homo sapiens 6 ULBP3 17 106 76 CCDS HistoryNCBI Gene:79465Re-query CCDS DB by CCDS ID:5225.1

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 5225.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000367339 ENSP00000356308 Accepted alive Link to Ensembl Transcript Viewer:ENST00000367339Link to Ensembl Protein Viewer:ENSP00000356308Re-query CCDS DB by Nucleotide ID:ENST00000367339Re-query CCDS DB by Protein ID:ENSP00000356308
Original member Current member EBI,WTSI ENST00000438272 ENSP00000403562 Accepted alive Link to Ensembl Transcript Viewer:ENST00000438272Link to Ensembl Protein Viewer:ENSP00000403562Re-query CCDS DB by Nucleotide ID:ENST00000438272Re-query CCDS DB by Protein ID:ENSP00000403562
Original member Current member EBI,WTSI OTTHUMT00000042678 OTTHUMP00000017411 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000042678Link to Vega Protein Viewer:OTTHUMP00000017411Re-query CCDS DB by Nucleotide ID:OTTHUMT00000042678Re-query CCDS DB by Protein ID:OTTHUMP00000017411
Original member Current member NCBI NM_024518.1 NP_078794.1 Accepted alive Link to Nucleotide Sequence:NM_024518.1Link to Protein Sequence:NP_078794.1Re-query CCDS DB by Nucleotide ID:NM_024518Re-query CCDS DB by Protein ID:NP_078794Link to BLink:NP_078794.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_078794.1 244 Q9BZM4 244 100% 0 0

Chromosomal Locations for CCDS 5225.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 150064607 150064713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 150065398 150065673 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 150065899 150066162 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 150068979 150069066 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (735 nt):
ATGGCAGCGGCCGCCAGCCCCGCGATCCTTCCGCGCCTCGCGATTCTTCCGTACCTGCTATTCGACTGGT
CC
GGGACGGGGCGGGCCGACGCTCACTCTCTCTGGTATAACTTCACCATCATTCATTTGCCCAGACATGG
G
CAACAGTGGTGTGAGGTCCAGAGCCAGGTGGATCAGAAGAATTTTCTCTCCTATGACTGTGGCAGTGAC
AAG
GTCTTATCTATGGGTCACCTAGAAGAGCAGCTGTATGCCACAGATGCCTGGGGAAAACAACTGGAAA
TG
CTGAGAGAGGTGGGGCAGAGGCTCAGACTGGAACTGGCTGACACTGAGCTGGAGGATTTCACACCCAG
T
GGACCCCTCACGCTGCAGGTCAGGATGTCTTGTGAGTGTGAAGCCGATGGATACATCCGTGGATCTTGG
CAG
TTCAGCTTCGATGGACGGAAGTTCCTCCTCTTTGACTCAAACAACAGAAAGTGGACAGTGGTTCACG
CT
GGAGCCAGGCGGATGAAAGAGAAGTGGGAGAAGGATAGCGGACTGACCACCTTCTTCAAGATGGTCTC
A
ATGAGAGACTGCAAGAGCTGGCTTAGGGACTTCCTGATGCACAGGAAGAAGAGGCTGGAACCCACAGCA
CCA
CCCACCATGGCCCCAGGCTTAGCTCAACCCAAAGCCATAGCCACCACCCTCAGTCCCTGGAGCTTCC
TC
ATCATCCTCTGCTTCATCCTCCCTGGCATCTGA


Translation (244 aa):
MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSD
K
VLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPS
GPLTLQVRMSCECEADGYIRGSW
Q
FSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPT
A
P
PTMAPGLAQPKAIATTLSPWSFLIILCFILPGI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser