NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7000.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7000.1 Public Homo sapiens 9 INPP5E 18 107 79 CCDS HistoryNCBI Gene:56623Re-query CCDS DB by CCDS ID:7000.1See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 7000.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000371712 ENSP00000360777 Accepted alive Link to Ensembl Transcript Viewer:ENST00000371712Link to Ensembl Protein Viewer:ENSP00000360777Re-query CCDS DB by Nucleotide ID:ENST00000371712Re-query CCDS DB by Protein ID:ENSP00000360777
Original member Current member EBI,WTSI OTTHUMT00000055058 OTTHUMP00000022575 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000055058Link to Vega Protein Viewer:OTTHUMP00000022575Re-query CCDS DB by Nucleotide ID:OTTHUMT00000055058Re-query CCDS DB by Protein ID:OTTHUMP00000022575
Original member Current member NCBI NM_019892.4 NP_063945.2 Accepted alive Link to Nucleotide Sequence:NM_019892.4Link to Protein Sequence:NP_063945.2Re-query CCDS DB by Nucleotide ID:NM_019892Re-query CCDS DB by Protein ID:NP_063945Link to BLink:NP_063945.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_063945.2 644 Q9NRR6-1 644 100% 0 0

Chromosomal Locations for CCDS 7000.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 136429675 136429807 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136430277 136430413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136431002 136431117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136431824 136431985 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136432479 136432586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136432956 136433075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136433155 136433279 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136434037 136434134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136434740 136434863 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 136438608 136439419 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1935 nt):
ATGCCGTCCAAGGCGGAGAATCTGCGGCCCTCCGAGCCGGCCCCGCAGCCGCCGGAAGGGAGGACGCTCC
AA
GGACAGCTTCCCGGCGCTCCGCCGGCCCAGCGCGCGGGGTCCCCACCCGATGCTCCGGGCTCCGAGAG
C
CCCGCGCTTGCCTGCAGCACTCCGGCCACGCCCAGCGGCGAGGACCCGCCAGCCCGAGCAGCACCCATC
GCC
CCGCGGCCCCCCGCCAGGCCTCGACTGGAGCGAGCCCTGTCCCTGGACGACAAGGGCTGGAGGAGGA
GG
CGTTTTCGAGGCAGCCAGGAGGACCTGGAAGCCCGGAATGGGACCAGTCCCTCCAGGGGCTCAGTGCA
G
AGCGAGGGCCCCGGGGCCCCCGCCCACAGCTGCTCCCCGCCCTGCCTGAGCACCTCCTTGCAGGAAATC
CCC
AAGTCCCGCGGGGTCCTGAGCAGTGAGAGAGGGAGCCCGTCCTCGGGGGGTAACCCTCTCTCTGGGG
TG
GCCAGCAGCTCCCCGAACCTCCCGCACAGAGACGCCGCCGTGGCGGGGAGCTCGCCCAGGCTGCCCAG
C
CTGCTGCCCCCGCGCCCACCGCCTGCCCTGAGCCTGGACATCGCCTCCGACTCCCTGAGGACAGCAAAC
AAG
GTCGACTCGGATCTTGCAGACTACAAGCTCCGCGCGCAGCCGCTCCTGGTGCGGGCCCACAGCAGCC
TG
GGCCCCGGCCGGCCGCGGAGCCCCCTGGCCTGCGACGACTGTTCCCTTCGCTCGGCCAAATCCTCCTT
C
AGCCTCCTGGCGCCCATCCGCAGCAAGGACGTCCGCAGCAGGAGTTACCTGGAGGGCAGCCTCCTGGCC
AGC
GGGGCCCTGTTGGGGGCGGATGAGCTGGCCCGCTACTTCCCAGACCGGAACGTGGCACTCTTCGTGG
CC
ACCTGGAACATGCAGGGCCAGAAGGAGCTCCCGCCCAGCCTGGACGAGTTCCTGCTCCCAGCCGAGGC
C
GACTATGCCCAGGACCTGTATGTCATCGGGGTCCAGGAGGGCTGTTCTGACAGGCGGGAGTGGGAGACT
CGT
CTGCAGGAGACGCTGGGCCCGCACTATGTGCTGCTGTCCTCGGCGGCCCACGGCGTGCTCTACATGT
CG
CTCTTCATCCGCAGGGACCTCATCTGGTTCTGCTCAGAGGTGGAGTGCTCCACGGTGACCACACGCAT
C
GTGTCTCAGATCAAGACCAAGGGGGCCTTGGGCATCAGCTTCACCTTTTTTGGCACTTCCTTCCTCTTC
ATC
ACGTCCCACTTCACCTCAGGTGACGGGAAGGTGGCGGAGCGGCTGCTGGACTACACCAGGACTGTAC
AA
GCCCTGGTCCTGCCCAGAAATGTGCCCGACACCAACCCCTATCGCTCCAGCGCAGCGGACGTCACCAC
C
CGCTTCGATGAGGTGTTCTGGTTTGGAGACTTCAACTTCCGCCTGAGTGGCGGGCGCACAGTCGTGGAC
GCC
CTCCTGTGCCAGGGCCTGGTGGTGGACGTGCCGGCGCTGCTGCAGCACGACCAGCTCATCCGGGAGA
TG
CGGAAAGGGTCCATCTTCAAGGGCTTCCAGGAGCCGGACATCCACTTCCTCCCATCATACAAGTTTGA
C
ATCGGGAAGGACACGTACGACAGCACCTCCAAGCAGAGGACGCCCTCATACACGGACCGCGTCTTGTAC
AGA
AGCCGCCACAAGGGTGACATCTGTCCTGTGAGCTACTCTTCCTGCCCCGGGATCAAGACGTCCGACC
AC
CGCCCTGTGTATGGCCTCTTCCGGGTGAAAGTGAGGCCGGGGCGAGACAACATTCCGTTGGCAGCTGG
C
AAATTTGATAGAGAACTGTACTTACTAGGAATTAAAAGACGGATTTCGAAGGAGATTCAGAGGCAGCAA
GCA
CTACAGAGTCAGAACTCCAGCACCATCTGCTCCGTTTCTTGA


Translation (644 aa):
MPSKAENLRPSEPAPQPPEGRTLQGQLPGAPPAQRAGSPPDAPGSESPALACSTPATPSGEDPPARAAPI
A
PRPPARPRLERALSLDDKGWRRRRFRGSQEDLEARNGTSPSRGSVQSEGPGAPAHSCSPPCLSTSLQEI
P
KSRGVLSSERGSPSSGGNPLSGVASSSPNLPHRDAAVAGSSPRLPSLLPPRPPPALSLDIASDSLRTAN
K
VDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKSSFSLLAPIRSKDVRS
RSYLEGSLLA
S
GALLGADELARYFPDRNVALFVATWNMQGQK
ELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWET
R
LQETLGPHYVLLSSAAHGVLYMSLFIRRDLIWFCS
EVECSTVTTRIVSQIKTKGALGISFTFFGTSFLF
I
TSHFT
SGDGKVAERLLDYTRTVQALVLPRNVPDTNPYRSSAADVTTRFDEVFWFGDFNFRLSGGRTVVD
A
LLCQGLVVDVPALLQHDQLIREMRK
GSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLY
R
SRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRD
NIPLAAGKFDRELYLLGIKRRISKEIQRQQ
A
LQSQNSSTICSVS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser