NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10037.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10037.1 Public Homo sapiens 15 NOP10 17 106 76 CCDS HistoryNCBI Gene:55505Re-query CCDS DB by CCDS ID:10037.1See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 10037.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000328848 ENSP00000332198 Accepted alive Link to Ensembl Transcript Viewer:ENST00000328848Link to Ensembl Protein Viewer:ENSP00000332198Re-query CCDS DB by Nucleotide ID:ENST00000328848Re-query CCDS DB by Protein ID:ENSP00000332198
Original member Current member EBI,WTSI OTTHUMT00000251602 OTTHUMP00000159812 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000251602Link to Vega Protein Viewer:OTTHUMP00000159812Re-query CCDS DB by Nucleotide ID:OTTHUMT00000251602Re-query CCDS DB by Protein ID:OTTHUMP00000159812
Original member Current member NCBI NM_018648.3 NP_061118.1 Accepted alive Link to Nucleotide Sequence:NM_018648.3Link to Protein Sequence:NP_061118.1Re-query CCDS DB by Nucleotide ID:NM_018648Re-query CCDS DB by Protein ID:NP_061118Link to BLink:NP_061118.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061118.1 64 Q9NPE3 64 100% 0 0

Chromosomal Locations for CCDS 10037.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 34341968 34342108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 34343020 34343073 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (195 nt):
ATGTTTCTCCAGTATTACCTCAACGAGCAGGGAGATCGAGTCTATACGCTGAAGAAATTTGACCCGATGG
GA
CAACAGACCTGCTCAGCCCATCCTGCTCGGTTCTCCCCAGATGACAAATACTCTCGACACCGAATCAC
C
ATCAAGAAACGCTTCAAGGTGCTCATGACCCAGCAACCGCGCCCTGTCCTCTGA


Translation (64 aa):
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser