NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11524.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11524.1 Public Homo sapiens 17 NFE2L1 18 107 79 CCDS HistoryNCBI Gene:4779Re-query CCDS DB by CCDS ID:11524.1See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 11524.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000362042 ENSP00000354855 Accepted alive Link to Ensembl Transcript Viewer:ENST00000362042Link to Ensembl Protein Viewer:ENSP00000354855Re-query CCDS DB by Nucleotide ID:ENST00000362042Re-query CCDS DB by Protein ID:ENSP00000354855
Original member Current member EBI,WTSI OTTHUMT00000443019 OTTHUMP00000259907 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000443019Link to Vega Protein Viewer:OTTHUMP00000259907Re-query CCDS DB by Nucleotide ID:OTTHUMT00000443019Re-query CCDS DB by Protein ID:OTTHUMP00000259907
Original member Current member NCBI NM_003204.2 NP_003195.1 Accepted alive Link to Nucleotide Sequence:NM_003204.2Link to Protein Sequence:NP_003195.1Re-query CCDS DB by Nucleotide ID:NM_003204Re-query CCDS DB by Protein ID:NP_003195Link to BLink:NP_003195.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003195.1 772 Q14494-1 772 100% 0 0

Chromosomal Locations for CCDS 11524.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 48051119 48051628 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 48056386 48056598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 48057032 48057121 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 48057344 48057502 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 48058295 48059641 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2319 nt):
ATGCTTTCTCTGAAGAAATACTTAACGGAAGGACTTCTCCAGTTCACCATTCTGCTGAGTTTGATTGGGG
TA
CGGGTGGACGTGGATACTTACCTGACCTCACAGCTTCCCCCACTCCGGGAGATCATCCTGGGGCCCAG
T
TCTGCCTATACTCAGACCCAGTTCCACAACCTGAGGAATACCTTGGATGGCTATGGTATCCACCCCAAG
AGC
ATAGACCTGGACAATTACTTCACTGCCCGGCGGCTCCTCAGTCAGGTGAGGGCCCTGGACAGGTTCC
AG
GTGCCAACCACTGAGGTAAATGCCTGGCTGGTTCACCGAGACCCAGAGGGGTCTGTCTCTGGCAGTCA
G
CCCAACTCAGGCCTCGCCCTCGAGAGTTCCAGTGGCCTCCAAGATGTGACAGGCCCAGACAACGGGGTG
CGA
GAAAGCGAAACGGAGCAGGGATTCGGTGAAGATTTGGAGGATTTGGGGGCTGTAGCCCCCCCAGTCA
GT
GGAGACTTAACCAAAGAGGACATAGATCTGATTGACATCCTTTGGCGACAGGATATTGATCTGGGGGC
T
GGGCGTGAGGTTTTTGACTATAGTCACCGCCAGAAGGAGCAGGATGTGGAGAAGGAGCTGCGAGATGGA
GGC
GAGCAGGACACCTGGGCAGGCGAGGGCGCGGAAGCTCTGGCACGGAACCTGCTAGTGGATGGAGAGA
CT
GGGGAGAGCTTCCCTGCACAGGTGCCTAGTGGGGAGGACCAGACGGCCCTGTCCCTGGAAGAGTGCCT
T
AGGCTGCTGGAAGCCACCTGCCCCTTTGGGGAGAATGCTGAGTTTCCAGCAGACATTTCCAGCATAACA
GAA
GCAGTGCCTAGTGAGAGTGAGCCCCCTGCTCTTCAAAACAACCTCTTGTCTCCTCTTCTGACCGGGA
CA
GAGTCACCATTTGATTTGGAACAGCAGTGGCAAGATCTCATGTCCATCATGGAAATGCAGGCCATGGA
A
GTGAACACATCAGCAAGTGAAATCCTGTACAGTGCCCCTCCTGGAGACCCACTGAGCACCAACTACAGC
CTT
GCCCCCAACACTCCCATCAATCAGAATGTCAGCCTGCATCAGGCGTCCCTGGGGGGCTGCAGCCAGG
AC
TTCTTACTCTTCAGCCCCGAGGTGGAAAGCCTGCCTGTGGCCAGTAGCTCCACGCTGCTCCCGTTGGC
C
CCCAGCAATTCTACCAGCCTCAACTCCACCTTCGGCTCCACCAACCTGACAGGGCTCTTCTTTCCACCC
CAG
CTCAATGGCACAGCCAATGACACAGCAGGCCCAGAGCTGCCTGACCCTTTGGGGGGTCTGTTAGATG
AA
GCTATGTTGGATGAGATCAGCCTTATGGACCTGGCCATTGAAGAAGGCTTTAACCCTGTGCAGGCCTC
C
CAGCTGGAGGAGGAATTTGACTCTGACTCAGGCCTTTCCTTAGACTCGAGCCATAGCCCTTCTTCCCTA
AGC
AGCTCTGAAGGCAGTTCTTCCTCTTCTTCCTCCTCCTCTTCCTCTTCTTCCTCTGCTTCTTCCTCTG
CC
TCTTCCTCCTTTTCTGAGGAAGGTGCGGTTGGCTACAGCTCTGACTCTGAGACCCTGGATCTGGAAGA
G
GCCGAGGGTGCTGTGGGCTACCAGCCTGAGTATTCCAAGTTCTGCCGCATGAGCTACCAGGATCCAGCT
CAG
CTCTCATGCCTGCCCTACCTGGAGCACGTGGGCCACAACCACACATACAACATGGCACCCAGTGCCC
TG
GACTCAGCCGACCTGCCACCACCCAGTGCCCTCAAGAAAGGCAGCAAGGAGAAGCAGGCTGACTTCCT
G
GACAAGCAGATGAGCCGGGATGAGCACCGAGCCCGAGCCATGAAGATCCCTTTCACCAATGACAAAATC
ATC
AACCTGCCTGTGGAGGAGTTCAATGAACTGCTGTCCAAATACCAGTTGAGTGAAGCCCAGCTGAGCC
TC
ATCCGAGACATCCGGCGCCGGGGCAAGAACAAGATGGCGGCGCAGAACTGCCGCAAGCGCAAGCTGGA
C
ACCATCCTGAATCTGGAGCGTGATGTGGAGGACCTGCAGCGTGACAAAGCCCGGCTGCTGCGGGAGAAA
GTG
GAGTTCCTGCGCTCCCTGCGACAGATGAAGCAGAAGGTCCAGAGCCTGTACCAGGAGGTGTTTGGGC
GG
CTGCGAGATGAGAACGGACGACCCTACTCGCCCAGTCAGTATGCGCTCCAGTACGCCGGGGACGGCAG
T
GTCCTCCTCATCCCCCGCACGATGGCCGACCAGCAGGCCCGGCGGCAGGAGAGGAAGCCAAAGGACCGG
AGA
AAGTGA


Translation (772 aa):
MLSLKKYLTEGLLQFTILLSLIGVRVDVDTYLTSQLPPLREIILGPSSAYTQTQFHNLRNTLDGYGIHPK
S
IDLDNYFTARRLLSQVRALDRFQVPTTEVNAWLVHRDPEGSVSGSQPNSGLALESSSGLQDVTGPDNGV
R
ESETEQGFGEDLEDLGAVAPPVSGDLTKE
DIDLIDILWRQDIDLGAGREVFDYSHRQKEQDVEKELRDG
G
EQDTWAGEGAEALARNLLVDGETGESFPAQ
VPSGEDQTALSLEECLRLLEATCPFGENAEFPADISSIT
E
AVPSESEPPALQNNLLSPLLTGTESPFDLEQQWQDLMSIMEMQ
AMEVNTSASEILYSAPPGDPLSTNYS
L
APNTPINQNVSLHQASLGGCSQDFLLFSPEVESLPVASSSTLLPLAPSNSTSLNSTFGSTNLTGLFFPP
Q
LNGTANDTAGPELPDPLGGLLDEAMLDEISLMDLAIEEGFNPVQASQLEEEFDSDSGLSLDSSHSPSSL
S
SSEGSSSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSKFCRMSYQDPA
Q
LSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIPFTNDKI
I
NLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREK
V
EFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDR
R
K




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser