NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10918.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10918.1 Public Homo sapiens 16 CHST6 18 107 79 CCDS HistoryNCBI Gene:4166Re-query CCDS DB by CCDS ID:10918.1See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 10918.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000332272 ENSP00000328983 Accepted alive Link to Ensembl Transcript Viewer:ENST00000332272Link to Ensembl Protein Viewer:ENSP00000328983Re-query CCDS DB by Nucleotide ID:ENST00000332272Re-query CCDS DB by Protein ID:ENSP00000328983
Original member Current member EBI,WTSI ENST00000390664 ENSP00000375079 Accepted alive Link to Ensembl Transcript Viewer:ENST00000390664Link to Ensembl Protein Viewer:ENSP00000375079Re-query CCDS DB by Nucleotide ID:ENST00000390664Re-query CCDS DB by Protein ID:ENSP00000375079
Original member Current member EBI,WTSI OTTHUMT00000269028 OTTHUMP00000174952 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000269028Link to Vega Protein Viewer:OTTHUMP00000174952Re-query CCDS DB by Nucleotide ID:OTTHUMT00000269028Re-query CCDS DB by Protein ID:OTTHUMP00000174952
Original member Current member EBI,WTSI OTTHUMT00000435478 OTTHUMP00000255909 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000435478Link to Vega Protein Viewer:OTTHUMP00000255909Re-query CCDS DB by Nucleotide ID:OTTHUMT00000435478Re-query CCDS DB by Protein ID:OTTHUMP00000255909
Original member Current member NCBI NM_021615.4 NP_067628.1 Accepted alive Link to Nucleotide Sequence:NM_021615.4Link to Protein Sequence:NP_067628.1Re-query CCDS DB by Nucleotide ID:NM_021615Re-query CCDS DB by Protein ID:NP_067628Link to BLink:NP_067628.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067628.1 395 Q9GZX3 395 100% 0 0

Chromosomal Locations for CCDS 10918.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 75478641 75479828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1188 nt):
ATGTGGCTGCCGCGCGTCTCCAGCACAGCAGTGACCGCGCTCCTCCTGGCGCAGACCTTCCTCCTCCTCT
TT
CTGGTTTCCCGGCCAGGGCCCTCGTCCCCAGCAGGCGGCGAGGCGCGCGTGCATGTGCTGGTGCTGTC
C
TCGTGGCGCTCGGGCTCGTCCTTCGTGGGCCAACTCTTCAACCAGCACCCCGACGTCTTCTACCTAATG
GAG
CCCGCGTGGCACGTGTGGACCACCCTGTCGCAGGGCAGCGCCGCAACGCTGCACATGGCTGTGCGCG
AC
CTGGTGCGCTCCGTCTTCCTGTGCGACATGGACGTGTTTGATGCCTATCTGCCTTGGCGCCGCAACCT
G
TCCGACCTCTTCCAGTGGGCCGTGAGCCGTGCACTGTGCTCGCCACCCGCCTGCAGTGCCTTTCCCCGA
GGC
GCCATCAGCAGCGAGGCCGTGTGCAAGCCACTGTGCGCGCGGCAGTCCTTCACCCTGGCCCGGGAGG
CC
TGCCGCTCCTACAGCCACGTGGTGCTCAAGGAGGTGCGCTTCTTCAACCTGCAGGTGCTCTACCCGCT
G
CTCAGCGACCCCGCGCTCAACCTACGCATCGTGCACCTGGTGCGCGACCCGCGGGCCGTGCTGCGCTCC
CGG
GAGCAGACAGCCAAGGCTCTGGCGCGTGACAACGGCATCGTGCTGGGCACCAACGGCACGTGGGTGG
AG
GCCGACCCCGGCCTGCGCGTGGTGCGCGAGGTGTGCCGTAGCCACGTACGCATCGCCGAGGCCGCCAC
A
CTCAAGCCGCCACCCTTTCTGCGCGGCCGCTACCGCCTGGTGCGCTTCGAGGACCTGGCGCGGGAGCCG
CTG
GCAGAAATCCGTGCGCTCTACGCCTTCACTGGGCTCAGTCTCACGCCACAGCTCGAGGCCTGGATCC
AT
AACATCACCCACGGATCTGGACCTGGTGCGCGCCGCGAAGCCTTCAAGACTTCGTCCAGGAATGCGCT
C
AACGTCTCCCAGGCCTGGCGCCATGCGCTGCCCTTTGCCAAGATCCGCCGCGTGCAGGAACTGTGCGCT
GGT
GCGCTGCAGCTGCTGGGCTACCGGCCTGTGTACTCTGAGGACGAGCAGCGCAACCTCGCCCTTGATC
TG
GTGCTGCCACGAGGCCTGAACGGCTTCACTTGGGCATCATCCACCGCCTCGCACCCCCGAAATTAG


Translation (395 aa):
MWLPRVSSTAVTALLLAQTFLLLFLVSRPGPSSPAGGEARVHVLVLSSWRSGSSFVGQLFNQHPDVFYLM
E
PAWHVWTTLSQGSAATLHMAVRDLVRSVFLCDMDVFDAYLPWRRNLSDLFQWAVSRALCSPPACSAFPR
G
AISSEAVCKPLCARQSFTLAREACRSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRS
R
EQTAKALARDNGIVLGTNGTWVEADPGLRVVREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAREP
L
AEIRALYAFTGLSLTPQLEAWIHNITHGSGPGARREAFKTSSRNALNVSQAWRHALPFAKIRRVQELCA
G
ALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser