NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21611.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21611.1 Public Mus musculus 7 Ubqlnl 16 104 75 CCDS HistoryNCBI Gene:244179Re-query CCDS DB by CCDS ID:21611.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21611.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000059121 ENSMUSP00000056365 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000059121Link to Ensembl Protein Viewer:ENSMUSP00000056365Re-query CCDS DB by Nucleotide ID:ENSMUST00000059121Re-query CCDS DB by Protein ID:ENSMUSP00000056365
Original member Current member EBI,WTSI OTTMUST00000045701 OTTMUSP00000020572 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045701Link to Vega Protein Viewer:OTTMUSP00000020572Re-query CCDS DB by Nucleotide ID:OTTMUST00000045701Re-query CCDS DB by Protein ID:OTTMUSP00000020572
Original member Current member NCBI NM_198624.3 NP_941026.2 Accepted alive Link to Nucleotide Sequence:NM_198624.3Link to Protein Sequence:NP_941026.2Re-query CCDS DB by Nucleotide ID:NM_198624Re-query CCDS DB by Protein ID:NP_941026Link to BLink:NP_941026.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_941026.2 610 Q14DL0 610 100% 0 0

Chromosomal Locations for CCDS 21611.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 104148456 104150288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1833 nt):
ATGCCGCGTATTATCTCTCGATCACCTAAGATGCCCCAGAGCAGGTATACAGCAGGTGTGCCTGCAGATG
GG
AAGATCTCTCCAGGTGTCATTCGAGTGATTGTGAAGACTCCAGGCAACCAGATCATCTTTACAGTAGC
T
GATGACACCTTAGTGAGGCAGTTCAAGGAGATTCTGTCTGCTCACTTCAAATGCCAAATGGAACAACTG
GTA
CTGGTCTTTATGGGCCGCCTTCTCAAAGACCATGACACATTGAGCCAGAGGGGCATCACAGATGGCC
AC
ATTATCCATGTGGTCATCAAGTCCAAGCATGGCCCCAGATCCCTGGCTCACTCTTTCCGGAACCTGGT
A
ACCAACAATCCCTGCCATCAAGACAGGAACCCTAAAGGAAATAGCAGCATGGTGTGCCAATCTGCAGGC
ATG
AATGAAACTAAAGTGGAGTCATCTCTTCTCATGGAGCCAGAGGCACCCAAGGTGGGTACTGAAAGCC
CA
GAAGTGGGTAGTCTAGAACATATTGCACAGGTGCTGGAGAATCTTTGTGTCCAGAGTCTGCTGTCTAA
T
ATGGACTTCGTGCATCAGATGCCTCCAGAACAACCATATATGGAAGAACTGATACAGCAGAACCCAGAA
GTT
TCCCATCTTCTTGACAATTCTGAGATCCTATGCCAGACTCTGGAGCTGGTCAGGCACCTTGCCATCA
TC
CAAGAGATAATGCAGATCCAGCAGCCAGCACAGAACCCTGAGTATCCACCAAACTCACAGCCATTCTT
G
GGTTTAGAAACAGTTCCAAATGGGAACAATCACCTGGGCCAGAGTTATGTCAATAACAACGATCATATG
CTC
AATGGTGTGCCTGATCTTTTGGAGGGCAACTGTTTTACAGCTCTTCTGGATGAACAAGTACTAGAAC
AA
GTCCAGACTCCTTCTCTATCTCAACCATTACCTCAAGAACAATGGGACCAGCTCTCTTCTTCCCAAGT
A
ATTTATGCAAATTCTTGTGGATTATCATCAATCACCCCAACAAATGCTACTCCAAATCACACCAACAAT
GTT
TCCAGGGAAAATCCAGCCATAGTTGCCACCCAGGGCCAAAGCAATGTCTGCGCTGTTCAGCAGCCAG
CT
GAGATTCCAGTCTTACCAACCATATCAATCAACCAGAAGCCTCAAGTTGATAAGGATACTACCATCAC
T
CTAGGTATCTCTGACCAGTGGTTAGAGGAAGATCTCCAGCAGTCTGATGACCAGACCAGTTCTCAGATC
ACA
GGAGGCATGATCCAGTTGCTTAGAAACCACCCACAAATGGCAGCTCAGATGCTGCTGCTCATGAATA
CG
TCCCAACTGAATGAGCAGTGGAGGCAGGAAACTCCCACACCCTTGCAGTCATCACAGCTCCATGACTT
G
CTTTTAGCCCTAGCCAACCCCAAAACATCACAAGCATTATTACAAATTGAGCATGGTCTGCAGCTATTG
GCT
ACAGAGGCTCCTGCCCTTTTGCCCTACATTGAACCTTACCTATGGGGTCTAGGTTGGCTTATTCCTT
CC
ATCTGTAGCTACCCTGATATAGTGCCCTGGACCTGGAATGTGCAAGACATGGCTGAGCCTCAGTGTCC
T
GAAAGCTGCCACAAATCTGAAACAGTCCTTCAGAAAGTACAGCCCCCGTCTGGAGACCCTTCCCATTCC
CTA
CAAGCCCCGGAGGTTCGTTTCAGCAAAGAGATGGAATGTCTCCAGGCCATGGGATTTGTGAATTATA
AT
GCCAACCTGCAAGCGCTCATAGCTACTGATGGTGACACTAATGCTGCTATTTATAAGCTCAAGAGTTC
T
CAGGGATTCTAA


Translation (610 aa):
MPRIISRSPKMPQSRYTAGVPADGKISPGVIRVIVKTPGNQIIFTVADDTLVRQFKEILSAHFKCQMEQL
V
LVFMGRLLKDHDTLSQRGITDGHIIHVVIKSKHGPRSLAHSFRNLVTNNPCHQDRNPKGNSSMVCQSAG
M
NETKVESSLLMEPEAPKVGTESPEVGSLEHIAQVLENLCVQSLLSNMDFVHQMPPEQPYMEELIQQNPE
V
SHLLDNSEILCQTLELVRHLAIIQEIMQIQQPAQNPEYPPNSQPFLGLETVPNGNNHLGQSYVNNNDHM
L
NGVPDLLEGNCFTALLDEQVLEQVQTPSLSQPLPQEQWDQLSSSQVIYANSCGLSSITPTNATPNHTNN
V
SRENPAIVATQGQSNVCAVQQPAEIPVLPTISINQKPQVDKDTTITLGISDQWLEEDLQQSDDQTSSQI
T
GGMIQLLRNHPQMAAQMLLLMNTSQLNEQWRQETPTPLQSSQLHDLLLALANPKTSQALLQIEHGLQLL
A
TEAPALLPYIEPYLWGLGWLIPSICSYPDIVPWTWNVQDMAEPQCPESCHKSETVLQKVQPPSGDPSHS
L
QAPEVRFSKEMECLQAMGFVNYNANLQALIATDGDTNAAIYKLKSSQGF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser