NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16462.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16462.1 Public Mus musculus 2 Rag2 19 105 81 CCDS HistoryNCBI Gene:19374Re-query CCDS DB by CCDS ID:16462.1See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16462.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044031 ENSMUSP00000038204 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044031Link to Ensembl Protein Viewer:ENSMUSP00000038204Re-query CCDS DB by Nucleotide ID:ENSMUST00000044031Re-query CCDS DB by Protein ID:ENSMUSP00000038204
Original member Current member EBI,WTSI ENSMUST00000111227 ENSMUSP00000106858 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111227Link to Ensembl Protein Viewer:ENSMUSP00000106858Re-query CCDS DB by Nucleotide ID:ENSMUST00000111227Re-query CCDS DB by Protein ID:ENSMUSP00000106858
Original member Current member EBI,WTSI OTTMUST00000034581 OTTMUSP00000015478 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000034581Link to Vega Protein Viewer:OTTMUSP00000015478Re-query CCDS DB by Nucleotide ID:OTTMUST00000034581Re-query CCDS DB by Protein ID:OTTMUSP00000015478
Original member Current member EBI,WTSI OTTMUST00000034582 OTTMUSP00000015479 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000034582Link to Vega Protein Viewer:OTTMUSP00000015479Re-query CCDS DB by Nucleotide ID:OTTMUST00000034582Re-query CCDS DB by Protein ID:OTTMUSP00000015479
Original member Current member NCBI NM_009020.3 NP_033046.1 Accepted alive Link to Nucleotide Sequence:NM_009020.3Link to Protein Sequence:NP_033046.1Re-query CCDS DB by Nucleotide ID:NM_009020Re-query CCDS DB by Protein ID:NP_033046Link to BLink:NP_033046.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033046.1 527 P21784 527 100% 0 0

Chromosomal Locations for CCDS 16462.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 101629347 101630930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1584 nt):
ATGTCCCTGCAGATGGTAACAGTGGGTCATAACATAGCCTTAATTCAACCAGGCTTCTCACTTATGAATT
TT
GATGGCCAAGTTTTCTTCTTTGGCCAGAAAGGCTGGCCTAAGAGATCCTGTCCTACTGGAGTCTTTCA
T
TTTGATATAAAACAAAATCATCTCAAACTGAAGCCTGCAATCTTCTCTAAAGATTCCTGCTACCTCCCA
CCT
CTTCGTTATCCAGCTACTTGCTCATACAAAGGCAGCATAGACTCTGACAAGCATCAATATATCATTC
AC
GGAGGGAAAACACCAAACAATGAGCTTTCCGATAAGATTTATATCATGTCTGTCGCTTGCAAGAATAA
C
AAAAAAGTTACTTTCCGTTGCACAGAGAAAGACTTAGTAGGAGATGTCCCTGAACCCAGATACGGCCAT
TCC
ATTGACGTGGTGTATAGTCGAGGGAAAAGCATGGGTGTTCTCTTTGGAGGACGTTCATACATGCCTT
CT
ACCCAGAGAACCACAGAAAAATGGAATAGTGTAGCTGACTGCCTACCCCATGTTTTCTTGATAGATTT
T
GAATTTGGGTGTGCTACATCATATATTCTCCCAGAACTTCAGGATGGGCTGTCTTTTCATGTTTCTATT
GCC
AGAAACGATACCGTTTATATTTTGGGAGGACACTCACTTGCCAGTAATATACGCCCTGCTAACTTGT
AT
AGAATAAGAGTGGACCTTCCCCTGGGTACCCCAGCAGTGAATTGCACAGTCTTGCCAGGAGGAATCTC
T
GTCTCCAGTGCAATCCTCACTCAAACAAACAATGATGAATTTGTTATTGTGGGTGGTTATCAGCTGGAA
AAT
CAGAAAAGGATGGTCTGCAGCCTTGTCTCTCTAGGGGACAACACGATTGAAATCAGTGAGATGGAGA
CT
CCTGACTGGACCTCAGATATTAAGCATAGCAAAATATGGTTTGGAAGCAACATGGGAAACGGGACTAT
T
TTCCTTGGCATACCAGGAGACAATAAGCAGGCTATGTCAGAAGCATTCTATTTCTATACTTTGAGATGC
TCT
GAAGAGGATTTGAGTGAAGATCAGAAAATTGTCTCCAACAGTCAGACATCAACAGAAGATCCTGGGG
AC
TCCACTCCCTTTGAAGACTCAGAGGAATTTTGTTTCAGTGCTGAAGCAACCAGTTTTGATGGTGACGA
T
GAATTTGACACCTACAATGAAGATGATGAAGATGACGAGTCTGTAACCGGCTACTGGATAACATGTTGC
CCT
ACTTGTGATGTTGACATCAATACCTGGGTTCCGTTCTATTCAACGGAGCTCAATAAACCCGCCATGA
TC
TATTGTTCTCATGGGGATGGGCACTGGGTACATGCCCAGTGCATGGATTTGGAAGAACGCACACTCAT
C
CACTTGTCAGAAGGAAGCAACAAGTATTATTGCAATGAACATGTACAGATAGCAAGAGCATTGCAAACT
CCC
AAAAGAAACCCCCCCTTACAAAAACCTCCAATGAAATCCCTCCACAAAAAAGGCTCTGGGAAAGTCT
TG
ACTCCTGCCAAGAAATCCTTCCTTAGAAGACTGTTTGATTAA


Translation (527 aa):
MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAIFSKDSCYLP
P
LRYPATCSYKGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGH
S
IDVVYSRGKSMGVLFGGRSYMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSFHVSI
A
RNDTVYILGGHSLASNIRPANLYRIRVDLPLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE
N
QKRMVCSLVSLGDNTIEISEMETPDWTSDIKHSKIWFGSNMGNGTIFLGIPGDNKQAMSEAFYFYTLRC
S
EEDLSEDQKIVSNSQTSTEDPGDSTPFEDSEEFCFSAEATSFDGDDEFDTYNEDDEDDESVTGYWITCC
P
TCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARALQT
P
KRNPPLQKPPMKSLHKKGSGKVLTPAKKSFLRRLFD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser