NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS42078.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42078.1 Public Homo sapiens 15 MESP2 18 107 79 CCDS HistoryNCBI Gene:145873Re-query CCDS DB by CCDS ID:42078.1See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Sequence IDs included in CCDS 42078.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000341735 ENSP00000342392 Accepted alive Link to Ensembl Transcript Viewer:ENST00000341735Link to Ensembl Protein Viewer:ENSP00000342392Re-query CCDS DB by Nucleotide ID:ENST00000341735Re-query CCDS DB by Protein ID:ENSP00000342392
Original member Current member EBI,WTSI OTTHUMT00000416421 OTTHUMP00000247433 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000416421Link to Vega Protein Viewer:OTTHUMP00000247433Re-query CCDS DB by Nucleotide ID:OTTHUMT00000416421Re-query CCDS DB by Protein ID:OTTHUMP00000247433
Original member Current member NCBI NM_001039958.1 NP_001035047.1 Accepted alive Link to Nucleotide Sequence:NM_001039958.1Link to Protein Sequence:NP_001035047.1Re-query CCDS DB by Nucleotide ID:NM_001039958Re-query CCDS DB by Protein ID:NP_001035047Link to BLink:NP_001035047.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001035047.1 397 Q0VG99 397 100% 0 0

Chromosomal Locations for CCDS 42078.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 89776358 89777281 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 89778065 89778334 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1194 nt):
ATGGCCCAGTCGCCTCCTCCGCAGAGCCTCCTCGGCCACGACCACTGGATCTTCGCCCAGGGCTGGGGCT
GG
GCCGGCCACTGGGACTCCACGTCCCCGGCCTCCTCCTCCGATTCGTCGGGTTCGTGCCCCTGCGACGG
C
GCCCGCGGACTCCCGCAGCCACAGCCTCCGAGCTGCAGCTCCCGAGCCGCAGAGGCAGCCGCGACGACG
CCC
AGACGAGCGCGCACCGGACCAGCGGGCGGACAGCGGCAGAGCGCCAGCGAGCGGGAGAAACTGCGCA
TG
CGCACGCTGGCCCGCGCCCTGCACGAGTTGCGCCGCTTTCTGCCTCCCTCCTTGGCGCCGGCCGGCCA
G
AGCCTGACCAAGATCGAGACGCTGCGCCTGGCCATCCGCTACATCGGCCACCTATCGGCCGTGCTGGGT
CTC
AGCGAGGAGAGTCTGCAGTGCCGGCGCAGGCAGCGCGGGGACGCGGGGTCCCCTTGGGGCTGCCCGC
TG
TGCCCCGACCGTGGCCCCGCAGAGGCGCAGACGCAGGCGGAGGGGCAGGGGCAAGGGCAGGGGCAGGG
G
CAGGGGCAAGGGCAGGGGCAAGGACAGGGGCAAGGACAGGGGCAAGGGCAGGGGCGCAGGCCGGGCCTG
GTC
TCCGCCGTCCTCGCCGAGGCGTCCTGGGGATCCCCGTCCGCCTGCCCCGGAGCCCAAGCCGCACCCG
AG
CGCCTGGGGAGGGGGGTCCACGACACGGATCCCTGGGCAACACCCCCTTACTGCCCCAAGATACAGTC
G
CCCCCGTATTCGTCCCAAGGGACAACCTCCGACGCGTCTCTTTGGACGCCACCCCAAGGCTGTCCCTGG
ACG
CAGTCGTCCCCAGAGCCCCGGAACCCACCAGTGCCCTGGACGGCGGCCCCAGCAACTTTGGAGCTGG
CC
GCAGTGTACCAGGGTCTCTCTGTGTCTCCAGAGCCCTGTCTGTCGCTGGGAGCTCCATCTCTCCTGCC
C
CACCCATCATGCCAGAGACTGCAGCCTCAGACCCCCGGGAGGTGCTGGAGCCACAGTGCAGAGGTGGTG
CCC
AACTCAGAGGACCAGGGACCGGGCGCCGCCTTCCAGCTCAGTGAAGCAAGCCCTCCCCAGAGCTCAG
GC
CTGCGGTTCAGTGGCTGCCCTGAACTTTGGCAAGAAGATCTGGAGGGGGCCCGCCTGGGCATCTTCTA
C
TAA


Translation (397 aa):
MAQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATT
P
RRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETLRLAIRYIGHLSAVLG
L
SEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQGQGQGQGQGQGQGQGQGQGQGQGQGRRPGL
V
SAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWATPPYCPKIQSPPYSSQGTTSDASLWTPPQGCPW
T
QSSPEPRNPPVPWTAAPATLELAAVYQ
GLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPGRCWSHSAEVV
P
NSEDQGPGAAFQLSEASPPQSSGLRFSGCPELWQEDLEGARLGIFY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser