NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8823.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8823.1 Public Homo sapiens 12 KRT83 17 106 76 CCDS HistoryNCBI Gene:3889Re-query CCDS DB by CCDS ID:8823.1Re-query CCDS DB by GeneID:3889See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 8823.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000293670 ENSP00000293670 Accepted alive Link to Ensembl Transcript Viewer:ENST00000293670Link to Ensembl Protein Viewer:ENSP00000293670Re-query CCDS DB by Nucleotide ID:ENST00000293670Re-query CCDS DB by Protein ID:ENSP00000293670
Original member Current member EBI,WTSI OTTHUMT00000405182 OTTHUMP00000241740 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000405182Link to Vega Protein Viewer:OTTHUMP00000241740Re-query CCDS DB by Nucleotide ID:OTTHUMT00000405182Re-query CCDS DB by Protein ID:OTTHUMP00000241740
Original member Current member NCBI NM_002282.3 NP_002273.3 Accepted alive Link to Nucleotide Sequence:NM_002282.3Link to Protein Sequence:NP_002273.3Re-query CCDS DB by Nucleotide ID:NM_002282Re-query CCDS DB by Protein ID:NP_002273Link to BLink:NP_002273.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002273.3 493 P78385 493 100% 0 0

Chromosomal Locations for CCDS 8823.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 52314631 52314818 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52315312 52315343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52315893 52316113 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52316468 52316593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52316859 52317023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52317681 52317776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52317910 52317970 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52319156 52319364 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 52320952 52321335 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1482 nt):
ATGACCTGTGGCTTCAACTCCATAGGCTGTGGGTTCCGCCCTGGAAACTTCAGCTGTGTCTCTGCCTGCG
GG
CCCCGGCCAAGCCGCTGCTGCATCACCGCCGCCCCCTACCGCGGCATCTCCTGCTACCGCGGCCTCAC
C
GGGGGCTTTGGCAGCCACAGCGTGTGCGGGGGCTTCCGCGCCGGCTCCTGCGGACGCAGCTTCGGCTAC
CGC
TCCGGGGGCGTGTGCGGACCCAGCCCCCCATGCATCACCACCGTGTCGGTCAACGAGAGCCTCCTCA
CG
CCCCTCAACCTGGAGATAGACCCCAACGCGCAGTGCGTGAAGCAGGAGGAGAAGGAGCAGATCAAGTC
C
CTCAACAGCAGATTCGCGGCCTTCATCGACAAGGTGCGCTTCCTGGAGCAGCAGAACAAGCTGCTGGAG
ACA
AAGCTGCAGTTCTACCAAAACCGCGAGTGCTGCCAGAGTAACCTGGAGCCCCTGTTTGCTGGCTACA
TC
GAGACTCTGCGGCGGGAGGCCGAGTGCGTGGAGGCTGACAGTGGGAGGCTGGCCTCAGAGCTCAACCA
C
GTGCAGGAGGTGCTGGAGGGCTACAAGAAGAAGTATGAAGAAGAAGTAGCACTTCGAGCCACAGCAGAG
AAC
GAGTTTGTGGCTCTAAAGAAGGATGTGGACTGCGCCTACCTCCGCAAGTCAGACCTGGAGGCCAACG
TG
GAGGCCCTGATCCAGGAGATTGACTTCCTGAGGCGGCTGTACGAGGAGGAGATCCGCATTCTCCAATC
C
CACATCTCAGACACCTCCGTGGTTGTCAAGCTGGACAACAGCCGGGACCTGAACATGGACTGCATCGTT
GCC
GAGATCAAGGCACAGTATGATGACATTGCCACCCGTAGCCGGGCTGAGGCCGAGTCCTGGTATCGCA
GC
AAGTGTGAGGAGATGAAGGCCACAGTGATCAGGCACGGGGAGACCCTGCGCCGCACCAAGGAGGAGAT
C
AACGAGCTGAACCGCATGATCCAGAGGCTGACAGCCGAGGTGGAGAATGCCAAGTGCCAGAACTCCAAG
CTG
GAAGCTGCGGTGGCCCAGTCTGAGCAGCAGGGTGAGGCGGCCCTCAGTGATGCCCGCTGCAAGCTGG
CC
GAGCTGGAGGGCGCCCTGCAGAAGGCCAAGCAAGACATGGCCTGCCTGATCAGGGAGTACCAGGAGGT
G
ATGAACTCCAAGCTAGGCCTGGATATCGAGATCGCCACCTACAGGCGCCTGCTGGAGGGCGAGGAGCAG
AG
G
CTGTGTGAAGGTGTTGAAGCTGTGAATGTCTGTGTCAGCAGCTCCCGGGGTGGGGTTGTGTGCGGGG
AT
CTCTGCGTGTCGGGCTCCCGGCCGGTGACGGGCAGCGTCTGCAGTGCCCCCTGCAACGGGAACCTGGT
G
GTGAGCACTGGTTTGTGCAAGCCCTGTGGCCAGCTGAACACCACCTGTGGAGGGGGCTCCTGCGGCCAG
GGG
AGGCATTAA


Translation (493 aa):
MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCGRSFGY
R
SGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDK
VRFLEQQNKLLE
T
KLQFYQNRECCQSNLEPLFAGYIETLRREAECVEADSGRLASELNHVQEVLEGYKK
KYEEEVALRATAE
N
EFVALKK
DVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEIRILQSHISDTSVVVKLDNSRDLNMDCIV
A
EIKAQYDDIATRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSK
L
EAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQ

R
LCEGVEAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNLVVSTGLCKPCGQLNTTCGGGSCGQ
G
RH




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser