NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8782.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8782.1 Public Homo sapiens 12 TUBA1C 15 105 74 CCDS HistoryNCBI Gene:84790Re-query CCDS DB by CCDS ID:8782.1Re-query CCDS DB by GeneID:84790

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 8782.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000301072 ENSP00000301072 Accepted alive Link to Ensembl Transcript Viewer:ENST00000301072Link to Ensembl Protein Viewer:ENSP00000301072Re-query CCDS DB by Nucleotide ID:ENST00000301072Re-query CCDS DB by Protein ID:ENSP00000301072
Original member Current member EBI,WTSI OTTHUMT00000404424 OTTHUMP00000241326 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000404424Link to Vega Protein Viewer:OTTHUMP00000241326Re-query CCDS DB by Nucleotide ID:OTTHUMT00000404424Re-query CCDS DB by Protein ID:OTTHUMP00000241326
Original member Current member NCBI NM_032704.3 NP_116093.1 Accepted alive Link to Nucleotide Sequence:NM_032704.3Link to Protein Sequence:NP_116093.1Re-query CCDS DB by Nucleotide ID:NM_032704Re-query CCDS DB by Protein ID:NP_116093Link to BLink:NP_116093.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_116093.1 449 Q9BQE3 449 100% 0 0

Chromosomal Locations for CCDS 8782.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 12 (NC_000012.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

Chromosome Start Stop Links
12 49658965 49658967 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 49663248 49663470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 49663611 49663759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 49666036 49667010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1350 nt):
ATGCGTGAGTGCATCTCCATCCACGTTGGCCAGGCTGGTGTCCAGATTGGCAATGCCTGCTGGGAGCTCT
AC
TGCCTGGAACACGGCATCCAGCCCGATGGCCAGATGCCAAGTGACAAGACCATTGGGGGAGGAGATGA
T
TCCTTCAACACCTTCTTCAGTGAAACGGGTGCTGGCAAGCATGTGCCCCGGGCAGTGTTTGTAGACTTG
GAA
CCCACAGTCATTGATGAAGTTCGCACTGGCACTTACCGCCAGCTCTTCCACCCTGAGCAACTCATCA
CA
GGCAAGGAAGATGCTGCCAATAACTATGCCCGAGGGCACTACACCATTGGCAAGGAGATCATTGACCT
C
GTGTTGGACCGAATTCGCAAGCTGGCTGACCAGTGCACCGGTCTTCAGGGCTTCTTGGTTTTCCACAGC
TTT
GGTGGGGGAACTGGTTCTGGGTTCACCTCGCTGCTCATGGAACGTCTCTCAGTTGATTATGGCAAGA
AG
TCCAAGCTGGAGTTCTCCATTTACCCGGCGCCCCAGGTTTCCACAGCTGTAGTTGAGCCCTACAACTC
C
ATCCTCACCACCCACACCACCCTGGAGCACTCTGATTGTGCCTTCATGGTAGACAATGAGGCCATCTAT
GAC
ATCTGTCGTAGAAACCTCGATATCGAGCGCCCAACCTACACTAACCTTAACCGCCTTATTAGCCAGA
TT
GTGTCCTCCATCACTGCTTCCCTGAGATTTGATGGAGCCCTGAATGTTGACCTGACAGAATTCCAGAC
C
AACCTGGTGCCCTACCCCCGCATCCACTTCCCTCTGGCCACATATGCCCCTGTCATCTCTGCTGAGAAA
GCC
TACCACGAACAGCTTACTGTAGCAGAGATCACCAATGCTTGCTTTGAGCCAGCCAACCAGATGGTGA
AA
TGTGACCCTCGCCATGGTAAATACATGGCTTGCTGCCTGTTATACCGTGGTGACGTGGTTCCCAAAGA
T
GTCAATGCTGCCATTGCCACCATCAAAACCAAGCGTACCATCCAGTTTGTGGATTGGTGCCCCACTGGC
TTC
AAGGTTGGCATTAATTACCAGCCTCCCACTGTGGTGCCTGGCGGAGACCTGGCCAAGGTACAGAGAG
CT
GTGTGCATGCTGAGCAATACCACAGCTGTTGCCGAGGCCTGGGCTCGCCTGGACCACAAGTTTGACCT
G
ATGTATGCCAAGCGTGCCTTTGTTCACTGGTACGTGGGTGAGGGGATGGAGGAAGGCGAGTTTTCAGAG
GCC
CGTGAGGACATGGCTGCCCTTGAGAAGGATTATGAGGAGGTTGGAGCAGATAGTGCTGACGGAGAGG
AT
GAGGGTGAAGAGTATTAA


Translation (449 aa):
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL
E
PTVI
DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS
F
GGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY
D
ICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK
A
YHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG
F
KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
A
REDMAALEKDYEEVGADSADGEDEGEEY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser