NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7345.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7345.1 Public Homo sapiens 10 KAT6B 15 105 74 CCDS HistoryNCBI Gene:23522Re-query CCDS DB by CCDS ID:7345.1Re-query CCDS DB by GeneID:23522

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 7345.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000287239 ENSP00000287239 Accepted alive Link to Ensembl Transcript Viewer:ENST00000287239Link to Ensembl Protein Viewer:ENSP00000287239Re-query CCDS DB by Nucleotide ID:ENST00000287239Re-query CCDS DB by Protein ID:ENSP00000287239
Original member Current member EBI,WTSI OTTHUMT00000048771 OTTHUMP00000019868 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000048771Link to Vega Protein Viewer:OTTHUMP00000019868Re-query CCDS DB by Nucleotide ID:OTTHUMT00000048771Re-query CCDS DB by Protein ID:OTTHUMP00000019868
Original member Current member NCBI NM_012330.3 NP_036462.2 Accepted alive Link to Nucleotide Sequence:NM_012330.3Link to Protein Sequence:NP_036462.2Re-query CCDS DB by Nucleotide ID:NM_012330Re-query CCDS DB by Protein ID:NP_036462Link to BLink:NP_036462.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036462.2 2073 Q8WYB5-1 2073 100% 0 0

Chromosomal Locations for CCDS 7345.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 10 (NC_000010.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

Chromosome Start Stop Links
10 76602616 76603236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76719728 76719836 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76729418 76729533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76729778 76729859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76732265 76732397 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76735157 76736088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76737074 76737195 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76738982 76739097 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76741545 76741686 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76744838 76744999 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76748777 76748870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76780340 76780571 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76780884 76781043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76781639 76781989 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76784716 76785007 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 76788247 76790804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6222 nt):
ATGGTAAAACTTGCAAACCCACTTTATACAGAGTGGATTCTTGAAGCTATACAGAAAATAAAAAAGCAAA
AG
CAAAGGCCCTCTGAAGAGAGAATCTGCCATGCGGTCAGTACTTCCCATGGGTTGGATAAGAAGACAGT
C
TCTGAACAGCTGGAACTCAGTGTTCAGGATGGCTCAGTTCTCAAAGTCACCAACAAAGGCCTTGCCTCC
TAT
AAGGACCCAGACAACCCTGGGCGCTTTTCATCAGTTAAACCAGGCACTTTTCCTAAGTCAGCCAAGG
GG
TCTAGAGGATCATGTAATGATCTCCGCAATGTGGATTGGAATAAACTTTTAAGGAGAGCAATTGAAGG
A
CTTGAGGAGCCGAATGGCTCCTCCCTGAAGAACATAGAGAAGTATCTCAGAAGTCAAAGTGATCTCACA
AGC
ACCACCAACAACCCAGCCTTTCAGCAGCGGCTGCGACTGGGGGCCAAACGCGCTGTGAATAATGGGA
GG
TTACTGAAAGACGGACCGCAGTACAGGGTCAATTATGGGAGCTTAGATGGCAAAGGGGCACCTCAGTA
T
CCCAGTGCATTCCCATCCTCGCTCCCACCTGTCAGCCTTCTACCCCATGAGAAAGACCAGCCCCGTGCT
GAT
CCCATTCCAATATGTAGCTTCTGTTTGGGGACTAAAGAATCAAATCGTGAAAAGAAACCAGAAGAAC
TC
CTCTCTTGTGCAGATTGTGGCAGTAGTGGACACCCATCCTGTTTGAAATTTTGTCCTGAATTAACAAC
A
AATGTAAAGGCCTTAAGGTGGCAGTGCATCGAATGCAAGACATGCAGTGCCTGTAGAGTCCAAGGCAGA
AAT
GCTGATAATATGCTTTTTTGTGATTCCTGTGATAGAGGATTTCATATGGAATGCTGTGACCCACCAC
TT
TCCAGAATGCCAAAAGGGATGTGGATTTGCCAAGTCTGCAGACCAAAGAAAAAGGGAAGAAAACTACT
T
CATGAGAAAGCTGCACAAATAAAACGACGATATGCAAAACCCATTGGACGACCGAAAAATAAATTAAAG
CAA
CGATTGTTGTCTGTAACCAGTGATGAAGGATCCATGAATGCATTCACAGGAAGGGGGTCACCTGGTA
GG
GGTCAAAAGACTAAAGTCTGTACCACACCTTCATCTGGTCATGCTGCATCTGGGAAGGACTCAAGCAG
C
AGATTGGCTGTTACAGACCCCACTCGGCCTGGTGCCACCACCAAAATCACCACCACCTCCACCTACATT
TCT
GCCTCTACACTTAAAGTTAACAAGAAAACCAAAGGGCTCATTGATGGCCTTACTAAGTTTTTTACAC
CA
TCACCTGATGGTCGCAGATCACGAGGTGAAATTATAGACTTTTCAAAGCACTATCGTCCAAGGAAAAA
G
GTCTCTCAGAAACAGTCATGCACTTCTCATGTGTTGGCTACAGGTACCACACAAAAGCTAAAACCTCCA
CCT
TCTTCACTTCCACCCCCAACCCCCATCTCCGGTCAGAGCCCCAGTTCACAAAAGTCCAGCACGGCCA
CT
TCTTCTCCCTCTCCCCAGAGTTCTTCCAGCCAGTGCAGTGTGCCCTCCCTGAGCAGCCTTACCACTAA
C
AGCCAGCTGAAGGCACTCTTTGATGGGCTTTCTCATATCTATACCACTCAGGGACAGTCTCGCAAAAAG
GGA
CACCCGAGTTATGCACCACCCAAACGTATGCGTCGTAAAACTGAATTATCTTCCACGGCAAAATCTA
AA
GCCCACTTCTTTGGCAAAAGAGATATTAGAAGTCGGTTTATTTCTCACTCCTCCTCCTCTAGCTGGGG
G
ATGGCTAGAGGAAGTATTTTTAAAGCAATTGCTCACTTCAAGCGAACAACTTTCCTTAAAAAGCACAGG
ATG
CTAGGCAGATTAAAATATAAAGTGACCCCTCAGATGGGGACCCCCTCACCAGGGAAGGGGAGCTTGA
CA
GACGGAAGGATTAAACCTGATCAGGATGATGATACTGAAATAAAAATAAACATCAAACAAGAAAGTGC
A
GATGTAAATGTGATTGGAAACAAGGATGTCGTTACTGAAGAGGATTTGGATGTTTTTAAGCAGGCCCAG
GAA
CTTTCTTGGGAGAAAATAGAGTGTGAGAGTGGGGTGGAAGACTGTGGCCGGTACCCTTCTGTGATTG
AA
TTTGGTAAATATGAAATCCAAACCTGGTACTCCTCGCCTTACCCACAGGAATATGCAAGATTACCAAA
G
CTTTACCTGTGTGAATTCTGTCTTAAATATATGAAAAGTAAAAATATTTTGCTAAGACACTCCAAGAAG
TGT
GGATGGTTTCATCCTCCAGCAAATGAAATTTACCGAAGGAAAGACCTTTCAGTATTTGAGGTTGATG
GG
AATATGAGCAAAATTTATTGCCAAAACCTTTGCTTGTTAGCCAAGCTCTTCCTGGACCACAAAACGTT
G
TATTATGATGTCGAGCCATTCCTTTTTTATGTCCTTACAAAAAATGATGAAAAGGGCTGTCATCTGGTT
GGA
TACTTCTCTAAGGAAAAGCTTTGCCAGCAGAAGTATAATGTCTCCTGCATAATGATCATGCCCCAGC
AC
CAAAGGCAAGGATTTGGACGGTTTCTCATTGATTTCAGCTATTTGCTTTCTAGAAGAGAAGGCCAAGC
A
GGGTCTCCTGAAAAGCCTCTCTCCGATCTGGGCCGTCTCTCCTACCTGGCATATTGGAAGAGCGTCATC
TTG
GAGTATCTCTACCACCACCATGAGAGGCACATCAGCATCAAGGCAATTAGCAGAGCGACGGGCATGT
GC
CCACATGACATTGCCACCACTCTGCAGCACCTCCACATGATCGACAAGAGAGATGGCAGATTTGTCAT
C
ATTAGACGGGAAAAGTTGATATTGAGCCACATGGAAAAGCTGAAAACCTGTTCCAGAGCCAATGAACTT
GAT
CCAGACAGTCTGAGGTGGACCCCAATTTTAATTTCTAATGCTGCAGTGTCTGAAGAAGAGCGAGAAG
CT
GAGAAAGAGGCTGAGCGGCTAATGGAACAAGCTAGCTGCTGGGAGAAGGAGGAACAAGAAATCCTGTC
A
ACTAGAGCTAACAGTAGGCAATCACCTGCAAAAGTACAATCGAAAAATAAATATTTGCATTCCCCGGAG
AGC
CGGCCAGTCACAGGGGAGCGAGGGCAGCTGCTGGAGCTGTCTAAAGAGAGCAGTGAAGAAGAAGAGG
AG
GAGGAGGACGAGGAGGAGGAAGAAGAGGAGGAAGAAGAGGAAGAGGATGAAGAGGAGGAAGAAGAGGA
A
GAAGAAGAAGAAGAAGAAGAAAATATTCAAAGCTCTCCCCCAAGATTGACGAAACCACAGTCAGTTGCC
ATA
AAGAGAAAGAGGCCTTTTGTACTAAAGAAGAAAAGGGGTCGTAAACGCAGGAGGATCAACAGCAGTG
TA
ACAACAGAGACCATTTCAGAGACGACAGAAGTACTGAATGAGCCCTTTGACAACTCAGATGAAGAGAG
G
CCAATGCCACAGCTGGAGCCTACCTGTGAGATTGAAGTGGAGGAAGATGGCAGGAAGCCAGTCCTGAGA
AAA
GCATTCCAGCATCAGCCTGGGAAGAAAAGACAAACAGAGGAAGAGGAAGGAAAAGACAATCATTGCT
TC
AAGAATGCTGACCCTTGTAGAAACAATATGAATGATGATTCAAGTAACTTGAAAGAAGGCAGTAAAGA
C
AATCCCGAACCTCTAAAGTGCAAACAAGTGTGGCCAAAAGGAACAAAGCGCGGTCTATCTAAGTGGAGG
CAA
AACAAAGAGAGGAAGACCGGATTTAAACTGAATTTGTACACCCCGCCAGAAACACCCATGGAGCCTG
AC
GAGCAGGTAACAGTGGAAGAACAGAAGGAGACTTCAGAAGGAAAAACCAGCCCCAGTCCCATCAGGAT
T
GAGGAGGAGGTCAAGGAAACTGGGGAAGCCCTGTTGCCTCAAGAGGAAAACAGAAGGGAAGAAACATGT
GCC
CCTGTAAGTCCAAACACATCACCAGGTGAAAAACCAGAAGATGATCTCATCAAACCTGAGGAAGAGG
AA
GAGGAGGAGGAGGAGGAAGAGGAAGAAGAGGAAGAAGAGGAAGGGGAAGAAGAAGAAGGAGGAGGAAA
T
GTAGAAAAAGATCCAGATGGTGCTAAAAGCCAAGAAAAAGAGGAACCAGAAATCTCCACGGAAAAAGAA
GAC
TCTGCACGTTTGGATGATCACGAAGAGGAGGAGGAAGAGGATGAAGAGCCATCCCACAACGAGGACC
AT
GATGCCGATGACGAGGATGACAGCCACATGGAGTCTGCCGAAGTGGAGAAGGAAGAGCTGCCCAGAGA
A
AGCTTCAAAGAAGTACTGGAAAACCAGGAGACTTTTTTAGACCTTAATGTGCAGCCTGGTCACTCGAAC
CCA
GAGGTCTTAATGGACTGTGGCGTCGACCTGACAGCTTCTTGTAACAGTGAGCCCAAGGAGCTTGCTG
GG
GACCCTGAAGCTGTACCCGAATCTGACGAGGAGCCACCCCCAGGAGAACAGGCACAGAAGCAGGACCA
A
AAGAACAGCAAGGAAGTCGATACAGAGTTCAAAGAGGGAAACCCAGCAACCATGGAAATCGACTCTGAG
ACT
GTCCAGGCCGTTCAGTCTTTGACCCAGGAGAGCAGCGAACAGGACGACACCTTTCAGGATTGTGCCG
AG
ACTCAAGAGGCCTGTAGAAGCCTACAGAACTACACCCGTGCAGACCAAAGTCCACAGATTGCCACCAC
G
CTCGACGATTGCCAACAGTCGGACCACAGTAGCCCAGTTTCATCCGTCCACTCCCATCCTGGCCAGTCC
GTA
CGTTCTGTCAACAGCCCAAGTGTCCCTGCTCTGGAAAACAGCTACGCCCAAATCAGCCCAGATCAAA
GT
GCCATCTCAGTGCCATCTCTGCAGAACATGGAAACCAGTCCCATGATGGATGTCCCATCAGTTTCAGA
T
CATTCACAGCAAGTCGTAGACAGTGGATTTAGTGACCTGGGCAGTATCGAGAGCACAACTGAGAACTAC
GAA
AACCCAAGCAGCTACGATTCTACTATGGGAGGCAGCATCTGTGGAAACGGCTCTTCACAGAACAGCT
GC
TCCTATAGCAACCTCACCTCCAGCAGTCTGACACAGAGCAGCTGTGCTGTCACCCAGCAGATGTCCAA
C
ATCAGCGGGAGCTGCAGCATGCTGCAGCAAACCAGCATCAGCTCCCCTCCGACCTGCAGCGTCAAGTCT
CCT
CAAGGCTGTGTGGTGGAGAGGCCTCCGAGCAGCAGCCAGCAGCTGGCTCAGTGCAGCATGGCTGCTA
AC
TTCACCCCACCCATGCAGCTGGCTGAAATCCCCGAGACGAGCAACGCCAACATTGGCTTATACGAGCG
A
ATGGGTCAGAGTGATTTTGGGGCTGGGCATTACCCGCAGCCGTCAGCCACCTTCAGCCTTGCCAAACTG
CAG
CAGTTAACTAATACACTTATTGATCATTCATTGCCTTACAGCCATTCCGCTGCTGTGACTTCCTATG
CA
AACAGTGCCTCTTTGTCCACACCATTAAGTAACACAGGGCTTGTTCAACTTTCTCAGTCTCCACACTC
C
GTCCCTGGGGGACCCCAAGCACAAGCTACCATGACCCCACCCCCCAACCTGACTCCTCCTCCAATGAAT
CTG
CCGCCGCCTCTTTTGCAACGGAACATGGCTGCATCAAATATTGGCATCTCTCACAGCCAAAGACTGC
AA
ACCCAGATTGCCAGCAAGGGCCACATCTCCATGAGAACCAAGTCAGCGTCTCTGTCACCAGCCGCTGC
C
ACCCATCAGTCACAAATCTATGGGCGCTCCCAGACTGTAGCCATGCAGGGTCCTGCACGGACTTTAACG
ATG
CAAAGAGGCATGAACATGAGTGTGAACCTGATGCCAGCGCCAGCCTACAATGTCAACTCTGTGAACA
TG
AACATGAACACTCTCAACGCCATGAATGGGTACAGCATGTCCCAGCCAATGATGAACAGTGGCTACCA
C
AGCAATCATGGCTATATGAATCAAACGCCCCAATACCCTATGCAGATGCAGATGGGCATGATGGGCACC
CAG
CCATATGCCCAGCAGCCAATGCAGACCCCACCCCACGGTAACATGATGTACACGGCCCCCGGACATC
AC
GGCTACATGAACACAGGCATGTCCAAACAGTCTCTCAATGGCTCCTACATGAGAAGGTAG


Translation (2073 aa):
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSVLKVTNKGLAS
Y
KDPDNPGRFSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNIEKYLRSQSDLT
S
TTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLDGKGAPQYPSAFPSSLPPVSLLPHEKDQ
PRA
D
PIPICSFCLGTKESNREKKPEELLSCADCGSS
GHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGR
N
A
DNMLFCDSCDRGFHMECCDPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLK
Q
RL
LSVTSDEGSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
S
ASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLATGTTQKLKPP
P
SSLPPPTPISGQSPSSQKSSTATSSPSPQSSSSQCSVPSLSSLTTNSQLKALFDGLSHIYTTQGQSRKK
G
HPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISHSSSSSWGMARGSIFKAIAHFKRTTFLKKHR
M
LGRLKYKVTPQMGTPSPGKGSLTDGRIKPDQDD
DTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQ
E
LSWE
KIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKK
C
GWFHPPANEIYRRKDLSVFE
VDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
G
YFSK
EKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYLAYWKSVI
L
EYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDG
RFVIIRREKLILSHMEKLKTCSRANEL
D
PDSLRWTPILISNAAVSEEEREAEKE
AERLMEQASCWEKEEQEILSTRANSRQSPAKVQSKNKYLHSPE
S
RPVTGERGQLLELSKESSEEEEEEEDEEEEEEEEEEEEDEEEEEEEEEEEEEENIQSSPPRLTKPQSVA
I
KRK
RPFVLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLR
K
AFQHQPGKKRQTEEEEGKDNHCFKNADPCR
NNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWR
Q
NKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEALLPQEENRREETC
A
PVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEEEEEGEEEEGGGNVEKDPDGAKSQEKEEPEISTEKE
D
SARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMESAEVEKEELPRESFKEVLENQETFLDLNVQPGHSN
P
EVLMDCGVDLTASCNSEPKELAGDPEAVPESDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSE
T
VQAVQSLTQESSEQDDTFQDCAETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQS
V
RSVNSPSVPALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENY
E
NPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSISSPPTCSVKS
P
QGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETSNANIGLYERMGQSDFGAGHYPQPSATFSLAKL
Q
QLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMTPPPNLTPPPMN
L
PPPLLQRNMAASNIGISHSQRLQTQIASKGHISMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLT
M
QRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGT
Q
PYAQQPMQTPPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser