NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7247.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7247.1 Public Homo sapiens 10 MBL2 15 105 74 CCDS HistoryNCBI Gene:4153Re-query CCDS DB by CCDS ID:7247.1Re-query CCDS DB by GeneID:4153

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 7247.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000373968 ENSP00000363079 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373968Link to Ensembl Protein Viewer:ENSP00000363079Re-query CCDS DB by Nucleotide ID:ENST00000373968Re-query CCDS DB by Protein ID:ENSP00000363079
Original member Current member EBI,WTSI OTTHUMT00000048115 OTTHUMP00000019622 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000048115Link to Vega Protein Viewer:OTTHUMP00000019622Re-query CCDS DB by Nucleotide ID:OTTHUMT00000048115Re-query CCDS DB by Protein ID:OTTHUMP00000019622
Original member Current member NCBI NM_000242.2 NP_000233.1 Accepted alive Link to Nucleotide Sequence:NM_000242.2Link to Protein Sequence:NP_000233.1Re-query CCDS DB by Nucleotide ID:NM_000242Re-query CCDS DB by Protein ID:NP_000233Link to BLink:NP_000233.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000233.1 248 P11226 248 100% 0 0

Chromosomal Locations for CCDS 7247.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 10 (NC_000010.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

Chromosome Start Stop Links
10 54527897 54528270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 54529007 54529075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 54530430 54530546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 54531209 54531395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (747 nt):
ATGTCCCTGTTTCCATCACTCCCTCTCCTTCTCCTGAGTATGGTGGCAGCGTCTTACTCAGAAACTGTGA
CC
TGTGAGGATGCCCAAAAGACCTGCCCTGCAGTGATTGCCTGTAGCTCTCCAGGCATCAACGGCTTCCC
A
GGCAAAGATGGGCGTGATGGCACCAAGGGAGAAAAGGGGGAACCAGGCCAAGGGCTCAGAGGCTTACAG
GGC
CCCCCTGGAAAGTTGGGGCCTCCAGGAAATCCAGGGCCTTCTGGGTCACCAGGACCAAAGGGCCAAA
AA
GGAGACCCTGGAAAAAGTCCGGATGGTGATAGTAGCCTGGCTGCCTCAGAAAGAAAAGCTCTGCAAAC
A
GAAATGGCACGTATCAAAAAGTGGCTCACCTTCTCTCTGGGCAAACAAGTTGGGAACAAGTTCTTCCTG
ACC
AATGGTGAAATAATGACCTTTGAAAAAGTGAAGGCCTTGTGTGTCAAGTTCCAGGCCTCTGTGGCCA
CC
CCCAGGAATGCTGCAGAGAATGGAGCCATTCAGAATCTCATCAAGGAGGAAGCCTTCCTGGGCATCAC
T
GATGAGAAGACAGAAGGGCAGTTTGTGGATCTGACAGGAAATAGACTGACCTACACAAACTGGAACGAG
GGT
GAACCCAACAATGCTGGTTCTGATGAAGATTGTGTATTGCTACTGAAAAATGGCCAGTGGAATGACG
TC
CCCTGCTCCACCTCCCATCTGGCCGTCTGTGAGTTCCCTATCTGA


Translation (248 aa):
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ
G
PPGKLGPPGNPGPSGSPGPKGQKGDPGKSP
DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL
T
NGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNE
G
EPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser