NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7241.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7241.1 Public Homo sapiens 10 A1CF 15 105 74 CCDS HistoryNCBI Gene:29974Re-query CCDS DB by CCDS ID:7241.1Re-query CCDS DB by GeneID:29974

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 7241.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000373997 ENSP00000363109 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373997Link to Ensembl Protein Viewer:ENSP00000363109Re-query CCDS DB by Nucleotide ID:ENST00000373997Re-query CCDS DB by Protein ID:ENSP00000363109
Original member Current member EBI,WTSI ENST00000374001 ENSP00000363113 Accepted alive Link to Ensembl Transcript Viewer:ENST00000374001Link to Ensembl Protein Viewer:ENSP00000363113Re-query CCDS DB by Nucleotide ID:ENST00000374001Re-query CCDS DB by Protein ID:ENSP00000363113
Original member Current member EBI,WTSI OTTHUMT00000048085 OTTHUMP00000019611 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000048085Link to Vega Protein Viewer:OTTHUMP00000019611Re-query CCDS DB by Nucleotide ID:OTTHUMT00000048085Re-query CCDS DB by Protein ID:OTTHUMP00000019611
Original member Current member EBI,WTSI OTTHUMT00000048088 OTTHUMP00000019614 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000048088Link to Vega Protein Viewer:OTTHUMP00000019614Re-query CCDS DB by Nucleotide ID:OTTHUMT00000048088Re-query CCDS DB by Protein ID:OTTHUMP00000019614
Original member Current member NCBI NM_001198818.1 NP_001185747.1 Accepted alive Link to Nucleotide Sequence:NM_001198818.1Link to Protein Sequence:NP_001185747.1Re-query CCDS DB by Nucleotide ID:NM_001198818Re-query CCDS DB by Protein ID:NP_001185747Link to BLink:NP_001185747.1
Original member Current member NCBI NM_014576.3 NP_055391.2 Accepted alive Link to Nucleotide Sequence:NM_014576.3Link to Protein Sequence:NP_055391.2Re-query CCDS DB by Nucleotide ID:NM_014576Re-query CCDS DB by Protein ID:NP_055391Link to BLink:NP_055391.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001185747.1 586 Q9NQ94-2 586 100% 0 0
NP_055391.2 586 Q9NQ94-2 586 100% 0 0

Chromosomal Locations for CCDS 7241.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 10 (NC_000010.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

Chromosome Start Stop Links
10 52566489 52566640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52569654 52569802 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52570800 52570936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52573617 52573798 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52575766 52576039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52580312 52580409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52587891 52588055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52595834 52596072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52601622 52601752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52603748 52603882 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 52619602 52619700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1761 nt):
ATGGAATCAAATCACAAATCCGGGGATGGATTGAGCGGCACTCAGAAGGAAGCAGCCCTCCGCGCACTGG
TC
CAGCGCACAGGATATAGCTTGGTCCAGGAAAATGGACAAAGAAAATATGGTGGCCCTCCACCTGGTTG
G
GATGCTGCACCCCCTGAAAGGGGCTGTGAAATTTTTATTGGAAAACTTCCCCGAGACCTTTTTGAGGAT
GAG
CTTATACCATTATGTGAAAAAATCGGTAAAATTTATGAAATGAGAATGATGATGGATTTTAATGGCA
AC
AATAGAGGATATGCATTTGTAACATTTTCAAATAAAGTGGAAGCCAAGAATGCAATCAAGCAACTTAA
T
AATTATGAAATTAGAAATGGGCGCCTCTTAGGGGTTTGTGCCAGTGTGGACAACTGCCGATTATTTGTT
GGG
GGCATCCCAAAAACCAAAAAGAGAGAAGAAATCTTATCGGAGATGAAAAAGGTTACTGAAGGTGTTG
TC
GATGTCATCGTCTACCCAAGCGCTGCAGATAAAACCAAAAACCGAGGCTTTGCCTTCGTGGAGTATGA
G
AGTCATCGAGCAGCTGCCATGGCGAGGAGGAAACTGCTACCAGGAAGAATTCAGTTATGGGGACATGGT
ATT
GCAGTAGACTGGGCAGAGCCAGAAGTAGAAGTTGATGAAGATACAATGTCTTCAGTGAAAATCCTAT
AT
GTAAGAAATCTTATGCTGTCTACCTCTGAAGAGATGATTGAAAAGGAATTCAACAATATCAAACCAGG
T
GCTGTGGAGAGGGTGAAGAAAATTCGAGACTATGCTTTTGTGCACTTCAGTAACCGAGAAGATGCAGTT
GAG
GCTATGAAAGCTTTAAATGGCAAGGTGCTGGATGGTTCCCCCATTGAAGTCACCCTAGCAAAACCAG
TG
GACAAGGACAGTTATGTTAGGTATACCCGAGGCACAGGTGGAAGGGGCACCATGCTGCAAGGAGAGTA
T
ACCTACTCTTTGGGCCAAGTTTATGATCCCACCACAACCTACCTTGGAGCTCCTGTCTTCTATGCCCCC
CAG
ACCTATGCAGCAATTCCCAGTCTTCATTTCCCAGCCACCAAAGGACATCTCAGCAACAGAGCCATTA
TC
CGAGCCCCTTCTGTTAGAGGGGCTGCGGGAGTGAGAGGACTGGGCGGCCGTGGCTATTTGGCATACAC
A
GGCCTGGGTCGAGGATACCAGGTCAAAGGAGACAAAAGAGAAGACAAACTCTATGACATTTTACCTGGG
ATG
GAGCTCACCCCAATGAATCCTGTCACATTAAAACCCCAAGGAATTAAACTCGCTCCCCAGATATTAG
AA
GAGATTTGTCAGAAAAATAACTGGGGACAGCCAGTGTACCAGCTGCACTCTGCTATTGGACAAGACCA
A
AGACAGCTATTCTTGTACAAAATAACTATTCCTGCTCTAGCCAGCCAGAATCCTGCAATCCACCCTTTC
ACA
CCTCCAAAGCTGAGTGCCTTTGTGGATGAAGCAAAGACGTATGCAGCCGAATACACCCTGCAGACCC
TG
GGCATCCCCACTGATGGAGGCGATGGCACCATGGCTACTGCTGCTGCTGCTGCTACTGCTTTCCCAGG
A
TATGCTGTCCCTAATGCAACTGCACCCGTGTCTGCAGCCCAGCTCAAGCAAGCGGTAACCCTTGGACAA
GAC
TTAGCAGCATATACAACCTATGAGGTCTACCCAACTTTTGCAGTGACTGCCCGAGGGGATGGATATG
GC
ACCTTCTGA


Translation (586 aa):
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFED
E
LIPLCEK
IGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFV
G
GIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLP
GRIQLWGHG
I
AVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKP
GAVERVKKIRDYAFVHFSNREDAV
E
AMKALNGK
VLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAP
Q
TYAAIPSLHFPATKGHLSNRAIIRAPSVR
GAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPG
M
ELTPMNPVTLKPQGIKLAPQ
ILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPF
T
PPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFP
GYAVPNATAPVSAAQLKQAVTLGQ
D
LAAYTTYEVYPTFAVTARGDGYGTF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser