NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6574.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6574.1 Public Homo sapiens 9 FANCG 17 106 76 CCDS HistoryNCBI Gene:2189Re-query CCDS DB by CCDS ID:6574.1Re-query CCDS DB by GeneID:2189See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 6574.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000378643 ENSP00000367910 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378643Link to Ensembl Protein Viewer:ENSP00000367910Re-query CCDS DB by Nucleotide ID:ENST00000378643Re-query CCDS DB by Protein ID:ENSP00000367910
Original member Current member EBI,WTSI OTTHUMT00000052269 OTTHUMP00000021319 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000052269Link to Vega Protein Viewer:OTTHUMP00000021319Re-query CCDS DB by Nucleotide ID:OTTHUMT00000052269Re-query CCDS DB by Protein ID:OTTHUMP00000021319
Original member Current member NCBI NM_004629.1 NP_004620.1 Accepted alive Link to Nucleotide Sequence:NM_004629.1Link to Protein Sequence:NP_004620.1Re-query CCDS DB by Nucleotide ID:NM_004629Re-query CCDS DB by Protein ID:NP_004620Link to BLink:NP_004620.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004620.1 622 O15287 622 100% 0 0

Chromosomal Locations for CCDS 6574.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 35074108 35074216 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35074371 35074494 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35074927 35075082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35075279 35075325 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35075465 35075754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35075962 35076028 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35076432 35076583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35076724 35076870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35076971 35077101 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35077264 35077399 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35078141 35078343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35078605 35078736 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35079151 35079241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 35079441 35079524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1869 nt):
ATGTCCCGCCAGACCACCTCTGTGGGCTCCAGCTGCCTGGACCTGTGGAGGGAAAAGAATGACCGGCTCG
TT
CGACAGGCCAAGGTGGCTCAGAACTCCGGTCTGACTCTGAGGCGACAGCAGTTGGCTCAGGATGCACT
G
GAAGGGCTCAGAGGGCTCCTCCATAGTCTGCAAGGGCTCCCTGCAGCTGTTCCTGTTCTTCCCTTGGAG
CTG
ACTGTCACCTGCAACTTCATTATCCTGAGGGCAAGCTTGGCCCAGGGTTTCACAGAGGATCAGGCCC
AG
GATATCCAGCGGAGCCTAGAGAGAGTGCTGGAGACACAGGAGCAGCAGGGGCCCAGGTTGGAACAGGG
G
CTCAGGGAGCTGTGGGACTCTGTCCTTCGTGCTTCCTGCCTTCTGCCGGAGCTGCTGTCTGCCCTGCAC
CGC
CTGGTTGGCCTGCAGGCTGCCCTCTGGTTGAGTGCTGACCGTCTTGGGGACCTGGCCTTGTTACTAG
AG
ACCCTGAATGGCAGCCAGAGTGGAGCCTCTAAGGATCTGCTGTTACTTCTGAAAACTTGGAGTCCCCC
A
GCTGAGGAATTAGATGCTCCATTGACCCTGCAGGATGCCCAGGGATTGAAGGATGTCCTCCTGACAGCA
TTT
GCCTACCGCCAAGGTCTCCAGGAGCTGATCACAGGGAACCCAGACAAGGCACTAAGCAGCCTTCATG
AA
GCGGCCTCAGGCCTGTGTCCACGGCCTGTGTTGGTCCAGGTGTACACAGCACTGGGGTCCTGTCACCG
T
AAGATGGGAAATCCACAGAGAGCACTGTTGTACTTGGTTGCAGCCCTGAAAGAGGGATCAGCCTGGGGT
CCT
CCACTTCTGGAGGCCTCTAGGCTCTATCAGCAACTGGGGGACACAACAGCAGAGCTGGAGAGTCTGG
AG
CTGCTAGTTGAGGCCTTGAATGTCCCATGCAGTTCCAAAGCCCCGCAGTTTCTCATTGAGGTAGAATT
A
CTACTGCCACCACCTGACCTAGCCTCACCCCTTCATTGTGGCACTCAGAGCCAGACCAAGCACATACTA
GCA
AGCAGGTGCCTACAGACGGGGAGGGCAGGAGACGCTGCAGAGCATTACTTGGACCTGCTGGCCCTGT
TG
CTGGATAGCTCGGAGCCAAGGTTCTCCCCACCCCCCTCCCCTCCAGGGCCCTGTATGCCTGAGGTGTT
T
TTGGAGGCAGCGGTAGCACTGATCCAGGCAGGCAGAGCCCAAGATGCCTTGACTCTATGTGAGGAGTTG
CTC
AGCCGCACATCATCTCTGCTACCCAAGATGTCCCGGCTGTGGGAAGATGCCAGAAAAGGAACCAAGG
AA
CTGCCATACTGCCCACTCTGGGTCTCTGCCACCCACCTGCTTCAGGGCCAGGCCTGGGTTCAACTGGG
T
GCCCAAAAAGTGGCAATTAGTGAATTTAGCAGGTGCCTCGAGCTGCTCTTCCGGGCCACACCTGAGGAA
AAA
GAACAAGGGGCAGCTTTCAACTGTGAGCAGGGATGTAAGTCAGATGCGGCACTGCAGCAGCTTCGGG
CA
GCCGCCCTAATTAGTCGTGGACTGGAATGGGTAGCCAGCGGCCAGGATACCAAAGCCTTACAGGACTT
C
CTCCTCAGTGTGCAGATGTGCCCAGGTAATCGAGACACTTACTTTCACCTGCTTCAGACTCTGAAGAGG
CTA
GATCGGAGGGATGAGGCCACTGCACTCTGGTGGAGGCTGGAGGCCCAAACTAAGGGGTCACATGAAG
AT
GCTCTGTGGTCTCTCCCCCTGTACCTAGAAAGCTATTTGAGCTGGATCCGTCCCTCTGATCGTGACGC
C
TTCCTTGAAGAATTTCGGACATCTCTGCCAAAGTCTTGTGACCTGTAG


Translation (622 aa):
MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGLPAAVPVLPLE
L
TVTCNFIILRASLAQGFTEDQAQDIQRSLER
VLETQEQQGPRLEQGLRELWDSVLRASCLLPELLSALH
R
LVGLQAALWLSADRLGDLALLLETLNGSQ
SGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTA
F
AYRQ
GLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWG
P
PLLEASRLYQQLGDTTAELESLELLVE
ALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHIL
A
SRCLQTG
RAGDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL
L
SRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFS
RCLELLFRATPEE
K
EQ
GAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLSVQMCPGNRDTYFHLLQTLKR
L
DRRDEATALWWRLEAQTKGSHEDAL
WSLPLYLESYLSWIRPSDRDAFLEEFRTSLPKSCDL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser