NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS5940.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5940.1 Public Homo sapiens 7 EN2 15 105 74 CCDS HistoryNCBI Gene:2020Re-query CCDS DB by CCDS ID:5940.1Re-query CCDS DB by GeneID:2020

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 5940.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000297375 ENSP00000297375 Accepted alive Link to Ensembl Transcript Viewer:ENST00000297375Link to Ensembl Protein Viewer:ENSP00000297375Re-query CCDS DB by Nucleotide ID:ENST00000297375Re-query CCDS DB by Protein ID:ENSP00000297375
Original member Current member EBI,WTSI OTTHUMT00000322337 OTTHUMP00000199895 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000322337Link to Vega Protein Viewer:OTTHUMP00000199895Re-query CCDS DB by Nucleotide ID:OTTHUMT00000322337Re-query CCDS DB by Protein ID:OTTHUMP00000199895
Original member Current member NCBI NM_001427.3 NP_001418.2 Accepted alive Link to Nucleotide Sequence:NM_001427.3Link to Protein Sequence:NP_001418.2Re-query CCDS DB by Nucleotide ID:NM_001427Re-query CCDS DB by Protein ID:NP_001418Link to BLink:NP_001418.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001418.2 333 P19622 333 100% 0 0

Chromosomal Locations for CCDS 5940.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 7 (NC_000007.13)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 155251073 155251757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 155255066 155255382 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1002 nt):
ATGGAGGAGAATGACCCCAAGCCTGGCGAAGCAGCGGCGGCGGTGGAGGGACAGCGGCAGCCGGAATCCA
GC
CCCGGCGGCGGCTCGGGCGGCGGCGGCGGTAGCAGCCCGGGCGAAGCGGACACCGGGCGCCGGCGGGC
T
CTGATGCTGCCCGCGGTCCTGCAGGCGCCCGGCAACCACCAGCACCCGCACCGCATCACCAACTTCTTC
ATC
GACAACATCCTGCGGCCCGAGTTCGGCCGGCGAAAGGACGCGGGGACCTGCTGTGCGGGCGCGGGAG
GA
GGAAGGGGCGGCGGAGCCGGCGGCGAAGGCGGCGCGAGCGGTGCGGAGGGAGGCGGCGGCGCGGGCGG
C
TCGGAGCAGCTCTTGGGCTCGGGCTCCCGAGAGCCCCGGCAGAACCCGCCATGTGCGCCCGGCGCGGGC
GGG
CCGCTCCCAGCCGCCGGCAGCGACTCTCCGGGTGACGGGGAAGGCGGCTCCAAGACGCTCTCGCTGC
AC
GGTGGCGCCAAGAAAGGCGGCGACCCCGGCGGCCCCCTGGACGGGTCGCTCAAGGCCCGCGGCTTGGG
C
GGCGGCGACCTGTCGGTGAGCTCGGACTCGGACAGCTCGCAAGCCGGCGCCAACCTGGGCGCGCAGCCC
ATG
CTCTGGCCGGCGTGGGTCTACTGTACGCGCTACTCGGACCGGCCTTCTTCAGGTCCCAGGTCTCGAA
AA
CCAAAGAAGAAGAACCCGAACAAAGAGGACAAGCGGCCGCGCACGGCCTTTACCGCCGAGCAGCTGCA
G
AGGCTCAAGGCCGAGTTCCAGACCAACAGGTACCTGACGGAGCAGCGGCGCCAGAGCCTGGCGCAGGAG
CTG
AGCCTCAACGAGTCACAGATCAAGATTTGGTTCCAGAACAAGCGCGCCAAGATCAAGAAGGCCACGG
GC
AACAAGAACACGCTGGCCGTGCACCTCATGGCACAGGGCTTGTACAACCACTCCACCACAGCCAAGGA
G
GGCAAGTCGGACAGCGAGTAG


Translation (333 aa):
MEENDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNHQHPHRITNFF
I
DNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQLLGSGSREPRQNPPCAPGAG
G
PLPAAGSDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQP
M
LWPAWVYCTRYSDRPSS
GPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQE
L
SLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser