NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4671.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4671.1 Public Homo sapiens 6 PPP1R11 15 105 74 CCDS HistoryNCBI Gene:6992Re-query CCDS DB by CCDS ID:4671.1Re-query CCDS DB by GeneID:6992

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 4671.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000376772 ENSP00000365963 Accepted alive Link to Ensembl Transcript Viewer:ENST00000376772Link to Ensembl Protein Viewer:ENSP00000365963Re-query CCDS DB by Nucleotide ID:ENST00000376772Re-query CCDS DB by Protein ID:ENSP00000365963
Original member Current member EBI,WTSI OTTHUMT00000076557 OTTHUMP00000029382 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000076557Link to Vega Protein Viewer:OTTHUMP00000029382Re-query CCDS DB by Nucleotide ID:OTTHUMT00000076557Re-query CCDS DB by Protein ID:OTTHUMP00000029382
Original member Current member NCBI NM_021959.2 NP_068778.1 Accepted alive Link to Nucleotide Sequence:NM_021959.2Link to Protein Sequence:NP_068778.1Re-query CCDS DB by Nucleotide ID:NM_021959Re-query CCDS DB by Protein ID:NP_068778Link to BLink:NP_068778.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068778.1 126 O60927 126 100% 0 0

Chromosomal Locations for CCDS 4671.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 6 (NC_000006.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 30035188 30035256 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 30036367 30036475 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 30036881 30037083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (381 nt):
ATGGCCGAGGCAGGGGCTGGGCTGAGCGAGACCGTCACTGAGACAACGGTTACCGTGACAACCGAGCCCG
AG
AACCGGAGCCTTACCATCAAACTTCGGAAACGGAAGCCAGAGAAAAAGGTAGAATGGACAAGTGACAC
T
GTGGACAATGAACACATGGGCCGCCGCTCATCCAAATGCTGCTGTATTTATGAGAAACCTCGGGCCTTT
GGC
GAGAGCTCCACGGAAAGTGATGAGGAGGAAGAAGAGGGCTGTGGTCATACACACTGTGTACGTGGCC
AC
CGCAAAGGACGGCGTCGTGCAACCCTAGGACCGACCCCCACCACCCCTCCCCAGCCTCCTGACCCTTC
C
CAGCCCCCTCCAGGGCCAATGCAGCACTAA


Translation (126 aa):
MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAF
G
ESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser