NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS418.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
418.1 Public Homo sapiens 1 MEAF6 17 106 76 CCDS HistoryNCBI Gene:64769Re-query CCDS DB by CCDS ID:418.1Re-query CCDS DB by GeneID:64769See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 418.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000373075 ENSP00000362166 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373075Link to Ensembl Protein Viewer:ENSP00000362166Re-query CCDS DB by Nucleotide ID:ENST00000373075Re-query CCDS DB by Protein ID:ENSP00000362166
Original member Current member EBI,WTSI OTTHUMT00000012162 OTTHUMP00000004402 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000012162Link to Vega Protein Viewer:OTTHUMP00000004402Re-query CCDS DB by Nucleotide ID:OTTHUMT00000012162Re-query CCDS DB by Protein ID:OTTHUMP00000004402
Original member Current member NCBI NM_022756.5 NP_073593.2 Accepted alive Link to Nucleotide Sequence:NM_022756.5Link to Protein Sequence:NP_073593.2Re-query CCDS DB by Nucleotide ID:NM_022756Re-query CCDS DB by Protein ID:NP_073593Link to BLink:NP_073593.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_073593.2 201 Q9HAF1-3 201 100% 0 0

Chromosomal Locations for CCDS 418.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 37494099 37494107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 37495885 37495918 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 37496707 37496736 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 37501804 37501996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 37509278 37509323 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 37509455 37509542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 37513423 37513538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 37514657 37514746 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (606 nt):
ATGGCGATGCACAACAAGGCGGCGCCGCCGCAGATCCCGGACACCCGGCGGGAGCTGGCGGAGCTCGTGA
AG
CGGAAGCAGGAGCTGGCGGAAACATTGGCAAATTTGGAGCGACAGATCTATGCTTTTGAGGGAAGCTA
C
CTGGAAGACACTCAGATGTATGGCAATATTATTCGTGGCTGGGATCGGTATCTGACCAACCAAAAAAAC
TCC
AATAGCAAAAATGATCGAAGGAACCGGAAGTTTAAGGAAGCTGAGCGGCTCTTCAGTAAATCCTCGG
TT
ACCTCAGCAGCTGCAGTAAGTGCATTGGCAGGAGTTCAGGACCAGCTCATTGAAAAGAGGGAGCCAGG
A
AGTGGGACGGAAAGTGACACTTCTCCAGACTTCCACAATCAGGAAAATGAGCCCAGCCAGGAGGACCCT
GAG
GATCTGGATGGATCTGTGCAGGGAGTGAAACCTCAGAAGGCTGCTTCTTCTACTTCCTCAGGGAGTC
AC
CACAGCAGCCATAAAAAGCGAAAGAATAAAAACCGGCACAGCCCGTCTGGCATGTTTGATTATGACTT
T
GAGATTGATCTGAAGTTAAACAAAAAACCACGAGCTGACTATTAG


Translation (201 aa):
MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKN
S
NSKNDRRNRKFKEAERLFSKSSVTSAA
AVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDP
E
DLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRH
SPSGMFDYDFEIDLKLNKKPRADY



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser