NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3937.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3937.1 Public Homo sapiens 5 OXCT1 18 107 79 CCDS HistoryNCBI Gene:5019Re-query CCDS DB by CCDS ID:3937.1Re-query CCDS DB by GeneID:5019See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3937.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000196371 ENSP00000196371 Accepted alive Link to Ensembl Transcript Viewer:ENST00000196371Link to Ensembl Protein Viewer:ENSP00000196371Re-query CCDS DB by Nucleotide ID:ENST00000196371Re-query CCDS DB by Protein ID:ENSP00000196371
Original member Current member EBI,WTSI OTTHUMT00000211594 OTTHUMP00000120012 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000211594Link to Vega Protein Viewer:OTTHUMP00000120012Re-query CCDS DB by Nucleotide ID:OTTHUMT00000211594Re-query CCDS DB by Protein ID:OTTHUMP00000120012
Original member Current member NCBI NM_000436.3 NP_000427.1 Accepted alive Link to Nucleotide Sequence:NM_000436.3Link to Protein Sequence:NP_000427.1Re-query CCDS DB by Nucleotide ID:NM_000436Re-query CCDS DB by Protein ID:NP_000427Link to BLink:NP_000427.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000427.1 520 P55809-1 520 100% 0 0

Chromosomal Locations for CCDS 3937.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 41731729 41731770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41739390 41739491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41749527 41749607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41762111 41762200 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41794003 41794078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41794677 41794749 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41801022 41801070 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41803069 41803163 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41805567 41805681 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41807331 41807438 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41840451 41840511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41842675 41842781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41850030 41850179 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41853419 41853554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41861314 41861404 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41862642 41862750 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 41870281 41870358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1563 nt):
ATGGCGGCTCTCAAACTCCTCTCCTCCGGGCTTCGGCTCTGCGCCTCTGCCCGCGGATCTGGGGCAACCT
GG
TACAAGGGATGTGTTTGTTCCTTTTCCACCAGTGCTCATCGCCATACCAAGTTTTATACAGATCCAGT
A
GAAGCTGTAAAAGACATCCCTGATGGTGCCACGGTTTTGGTTGGTGGTTTTGGGCTATGTGGAATTCCA
GAG
AATCTTATAGATGCTTTACTGAAAACTGGAGTAAAAGGACTAACTGCAGTCAGCAACAATGCAGGGG
TT
GACAATTTTGGTTTGGGGCTTTTGCTTCGGTCCAAGCAGATAAAACGCATGGTCTCTTCATATGTGGG
A
GAAAATGCAGAATTTGAACGACAGTACTTATCTGGTGAATTAGAAGTGGAGCTGACACCACAGGGCACA
CTT
GCAGAGAGGATCCGTGCAGGCGGGGCTGGAGTTCCTGCATTTTACACCCCAACAGGGTATGGGACCC
TG
GTACAAGAAGGAGGATCGCCCATCAAATACAACAAAGATGGCAGTGTTGCCATTGCCAGTAAGCCAAG
A
GAGGTGAGGGAGTTCAATGGTCAGCACTTTATTTTGGAGGAAGCAATTACAGGGGATTTTGCTTTGGTG
AAA
GCCTGGAAGGCGGACCGAGCAGGAAACGTGATTTTCAGGAAAAGTGCAAGGAATTTCAACTTGCCAA
TG
TGCAAAGCTGCAGAAACCACAGTGGTAGAGGTTGAAGAAATTGTGGATATTGGAGCATTTGCTCCAGA
A
GACATCCATATTCCTCAGATTTATGTACATCGCCTTATAAAGGGAGAAAAATATGAGAAAAGAATTGAG
CGT
TTATCAATCCGGAAAGAGGGAGATGGGGAAGCCAAATCTGCTAAACCTGGAGATGACGTAAGGGAAC
GA
ATCATCAAGAGGGCCGCTCTTGAGTTTGAGGATGGCATGTATGCTAATTTGGGCATAGGAATCCCTCT
C
CTGGCCAGCAATTTTATCAGCCCAAATATAACTGTTCATCTTCAAAGTGAAAATGGAGTTCTGGGTTTG
GGT
CCATATCCACGACAACATGAAGCTGATGCAGATCTCATCAATGCAGGCAAGGAAACAGTTACTATTC
TT
CCAGGAGCCTCTTTTTTCTCCAGCGATGAATCATTTGCAATGATTAGAGGTGGACACGTCGATCTGAC
A
ATGCTAGGAGCGATGCAGGTTTCCAAATATGGTGACCTGGCTAACTGGATGATACCTGGGAAGATGGTG
AAA
GGAATGGGAGGTGCTATGGATTTAGTGTCCAGTGCGAAAACCAAAGTGGTGGTCACCATGGAGCATT
CT
GCAAAGGGAAATGCACATAAAATCATGGAGAAATGTACATTACCATTGACTGGAAAGCAATGTGTCAA
C
CGCATTATTACTGAAAAGGCTGTGTTTGATGTGGACAAGAAGAAAGGGTTGACTCTGATTGAGCTCTGG
GAA
GGCCTGACAGTGGATGACGTACAGAAGAGTACTGGGTGTGATTTTGCAGTTTCACCAAAACTCATGC
CA
ATGCAGCAGATCGCAAATTGA


Translation (520 aa):
MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIP
E
NLIDALLKTGVKGLTAVSNNA
GVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGT
L
AERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPRE
VREFNGQHFILEEAITGDFALV
K
AWKADRAGNVIF
RKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE
R
LSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMY
ANLGIGIPLLASNFISPNITVHLQSENGVLGL
G
PYPRQHEADADLINA
GKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
K
GMGGAMDLVSSAKTKVVVTMEHSAK
GNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELW
E
GLTVDDVQKSTGCDFA
VSPKLMPMQQIAN



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser