NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3789.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3789.1 Public Homo sapiens 4 LRAT 17 106 76 CCDS HistoryNCBI Gene:9227Re-query CCDS DB by CCDS ID:3789.1Re-query CCDS DB by GeneID:9227See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3789.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000336356 ENSP00000337224 Accepted alive Link to Ensembl Transcript Viewer:ENST00000336356Link to Ensembl Protein Viewer:ENSP00000337224Re-query CCDS DB by Nucleotide ID:ENST00000336356Re-query CCDS DB by Protein ID:ENSP00000337224
Original member Current member EBI,WTSI ENST00000507827 ENSP00000426761 Accepted alive Link to Ensembl Transcript Viewer:ENST00000507827Link to Ensembl Protein Viewer:ENSP00000426761Re-query CCDS DB by Nucleotide ID:ENST00000507827Re-query CCDS DB by Protein ID:ENSP00000426761
Original member Current member EBI,WTSI OTTHUMT00000365245 OTTHUMP00000220354 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000365245Link to Vega Protein Viewer:OTTHUMP00000220354Re-query CCDS DB by Nucleotide ID:OTTHUMT00000365245Re-query CCDS DB by Protein ID:OTTHUMP00000220354
Original member Current member EBI,WTSI OTTHUMT00000365246 OTTHUMP00000220355 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000365246Link to Vega Protein Viewer:OTTHUMP00000220355Re-query CCDS DB by Nucleotide ID:OTTHUMT00000365246Re-query CCDS DB by Protein ID:OTTHUMP00000220355
Original member NCBI NM_004744.3 NP_004735.2 Updated not alive Link to Nucleotide Sequence:NM_004744.3Link to Protein Sequence:NP_004735.2Re-query CCDS DB by Nucleotide ID:NM_004744Re-query CCDS DB by Protein ID:NP_004735
Current member NCBI NM_004744.4 NP_004735.2 Accepted alive Link to Nucleotide Sequence:NM_004744.4Link to Protein Sequence:NP_004735.2Re-query CCDS DB by Nucleotide ID:NM_004744Re-query CCDS DB by Protein ID:NP_004735Link to BLink:NP_004735.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004735.2 230 O95237 230 100% 0 0

Chromosomal Locations for CCDS 3789.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 154744327 154744866 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154748984 154749136 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (693 nt):
ATGAAGAACCCCATGCTGGAGGTGGTGTCTTTACTACTGGAGAAGCTGCTCCTCATCTCCAACTTCACGC
TC
TTTAGTTCGGGCGCCGCGGGCGAAGACAAAGGGAGGAACAGTTTTTATGAAACCAGCTCTTTCCACCG
A
GGCGACGTGCTGGAGGTGCCCCGGACCCACCTGACCCACTATGGCATCTACCTAGGAGACAACCGTGTT
GCC
CACATGATGCCCGACATCCTGTTGGCCCTGACAGACGACATGGGGCGCACGCAGAAGGTGGTCTCCA
AC
AAGCGTCTCATCCTGGGCGTTATTGTCAAAGTGGCCAGCATCCGCGTGGACACAGTGGAGGACTTCGC
C
TACGGAGCTAACATCCTGGTCAATCACCTGGACGAGTCCCTCCAGAAAAAGGCACTGCTCAACGAGGAG
GTG
GCGCGGAGGGCTGAAAAGCTGCTGGGCTTTACCCCCTACAGCCTGCTGTGGAACAACTGCGAGCACT
TC
GTGACCTACTGCAGATATGGCACCCCGATCAGTCCCCAGTCCGACAAGTTTTGTGAGACTGTGAAGAT
A
ATTATTCGTGATCAGAGAAGTGTTCTTGCTTCAGCAGTCTTGGGATTGGCGTCTATAGTCTGTACGGGC
TTG
GTATCATACACTACCCTTCCTGCAATTTTTATTCCATTCTTCCTATGGATGGCTGGCTAA


Translation (230 aa):
MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRV
A
HMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGANILVNHLDESLQKKALLNEE
V
ARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQSDK
FCETVKIIIRDQRSVLASAVLGLASIVCTG
L
VSYTTLPAIFIPFFLWMAG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser