NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3788.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3788.1 Public Homo sapiens 4 FGG 17 106 76 CCDS HistoryNCBI Gene:2266Re-query CCDS DB by CCDS ID:3788.1Re-query CCDS DB by GeneID:2266

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3788.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000336098 ENSP00000336829 Accepted alive Link to Ensembl Transcript Viewer:ENST00000336098Link to Ensembl Protein Viewer:ENSP00000336829Re-query CCDS DB by Nucleotide ID:ENST00000336098Re-query CCDS DB by Protein ID:ENSP00000336829
Original member Current member EBI,WTSI OTTHUMT00000317581 OTTHUMP00000197058 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000317581Link to Vega Protein Viewer:OTTHUMP00000197058Re-query CCDS DB by Nucleotide ID:OTTHUMT00000317581Re-query CCDS DB by Protein ID:OTTHUMP00000197058
Original member Current member NCBI NM_021870.2 NP_068656.2 Accepted alive Link to Nucleotide Sequence:NM_021870.2Link to Protein Sequence:NP_068656.2Re-query CCDS DB by Nucleotide ID:NM_021870Re-query CCDS DB by Protein ID:NP_068656Link to BLink:NP_068656.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068656.2 453 P02679-1 453 100% 0 0

Chromosomal Locations for CCDS 3788.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 154604834 154605066 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154606705 154606982 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154608466 154608650 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154609630 154609763 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154610067 154610197 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154611805 154611898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154612018 154612201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154612391 154612435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154612532 154612609 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1362 nt):
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACAT
GT
GTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAAC
T
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAA
GAC
ATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTT
AT
AATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGA
A
GAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATAT
AAT
TCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAAC
CT
TGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGC
T
AAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATC
GAT
GGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACT
GG
ATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGA
G
AAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAAT
GGC
AGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACAT
AT
GCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGA
C
AAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGC
AAC
TGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTT
AT
TACCAAGGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCAC
T
TGGAAAACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATT
GGA
GAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCAGAGCACCCTGCGGAAACAGAAT
AT
GACTCACTTTACCCTGAGGATGATTTGTAG


Translation (453 aa):
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLE
D
ILHQVENKTSEVKQLIKAIQLTYNPDESSKP
NMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIY
N
SNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGK
DCQDIANKGAKQSGLYFIKPLKANQQFLVYCEI
D
GSGNGWTVFQK
RLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWN
G
RT
STADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG
N
CAEQDGSGWWMNKCHAGHLNGVYYQ
GGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
G
EGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser