NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3549.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3549.1 Public Homo sapiens 4 SLC4A4 18 107 79 CCDS HistoryNCBI Gene:8671Re-query CCDS DB by CCDS ID:3549.1Re-query CCDS DB by GeneID:8671See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3549.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000340595 ENSP00000344272 Accepted alive Link to Ensembl Transcript Viewer:ENST00000340595Link to Ensembl Protein Viewer:ENSP00000344272Re-query CCDS DB by Nucleotide ID:ENST00000340595Re-query CCDS DB by Protein ID:ENSP00000344272
Original member Current member EBI,WTSI OTTHUMT00000252158 OTTHUMP00000160355 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000252158Link to Vega Protein Viewer:OTTHUMP00000160355Re-query CCDS DB by Nucleotide ID:OTTHUMT00000252158Re-query CCDS DB by Protein ID:OTTHUMP00000160355
Original member Current member NCBI NM_003759.3 NP_003750.1 Accepted alive Link to Nucleotide Sequence:NM_003759.3Link to Protein Sequence:NP_003750.1Re-query CCDS DB by Nucleotide ID:NM_003759Re-query CCDS DB by Protein ID:NP_003750Link to BLink:NP_003750.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003750.1 1035 Q9Y6R1-2 1035 100% 0 0

Chromosomal Locations for CCDS 3549.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 71339249 71339505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71349912 71350072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71357008 71357187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71397577 71397653 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71440616 71440773 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71447646 71447733 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71450389 71450543 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71451188 71451301 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71453495 71453669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71466444 71466577 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71472699 71472970 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71486948 71487018 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71497501 71497692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71532062 71532175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71534227 71534388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71546350 71546528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71547648 71547720 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71555140 71555208 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71557712 71557885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71560093 71560254 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71563793 71563889 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 71567004 71567047 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3108 nt):
ATGTCCACTGAAAATGTGGAAGGGAAGCCCAGTAACCTTGGGGAGAGAGGAAGAGCCCGGAGCTCCACTT
TC
CTCAGGGTTGTCCAGCCAATGTTTAACCACAGTATTTTCACTTCTGCAGTCTCTCCTGCTGCAGAACG
C
ATCCGATTCATCTTGGGAGAGGAGGATGACAGCCCAGCTCCCCCTCAGCTCTTCACGGAACTGGATGAG
CTG
CTGGCCGTGGATGGGCAGGAGATGGAGTGGAAGGAAACAGCCAGGTGGATCAAGTTTGAAGAAAAAG
TG
GAACAGGGTGGGGAAAGATGGAGCAAGCCCCATGTGGCCACATTGTCCCTTCATAGTTTATTTGAGCT
G
AGGACATGTATGGAGAAAGGATCCATCATGCTTGATCGGGAGGCTTCTTCTCTCCCACAGTTGGTGGAG
ATG
ATTGTTGACCATCAGATTGAGACAGGCCTATTGAAACCTGAACTTAAGGATAAGGTGACCTATACTT
TG
CTCCGGAAGCACCGGCATCAAACCAAGAAATCCAACCTTCGGTCCCTGGCTGACATTGGGAAGACAGT
C
TCCAGTGCAAGTAGGATGTTTACCAACCCTGATAATGGTAGCCCAGCCATGACCCATAGGAATCTGACT
TCC
TCCAGTCTGAATGACATTTCTGATAAACCGGAGAAGGACCAGCTGAAGAATAAGTTCATGAAAAAAT
TG
CCACGTGATGCAGAAGCTTCCAACGTGCTTGTTGGGGAGGTTGACTTTTTGGATACTCCTTTCATTGC
C
TTTGTTAGGCTACAGCAGGCTGTCATGCTGGGTGCCCTGACTGAAGTTCCTGTGCCCACAAGGTTCTTG
TTC
ATTCTCTTAGGTCCTAAGGGGAAAGCCAAGTCCTACCACGAGATTGGCAGAGCCATTGCCACCCTGA
TG
TCTGATGAGGTGTTCCATGACATTGCTTATAAAGCAAAAGACAGGCACGACCTGATTGCTGGTATTGA
T
GAGTTCCTAGATGAAGTCATCGTCCTTCCACCTGGGGAATGGGATCCAGCAATTAGGATAGAGCCTCCT
AAG
AGTCTTCCATCCTCTGACAAAAGAAAGAATATGTACTCAGGTGGAGAGAATGTTCAGATGAATGGGG
AT
ACGCCCCATGATGGAGGTCACGGAGGAGGAGGACATGGGGATTGTGAAGAATTGCAGCGAACTGGACG
G
TTCTGTGGTGGACTAATTAAAGACATAAAGAGGAAAGCGCCATTTTTTGCCAGTGATTTTTATGATGCT
TTA
AATATTCAAGCTCTTTCGGCAATTCTCTTCATTTATCTGGCAACTGTAACTAATGCTATCACTTTTG
GA
GGACTGCTTGGGGATGCCACTGACAACATGCAGGGCGTGTTGGAGAGTTTCCTGGGCACTGCTGTCTC
T
GGAGCCATCTTTTGCCTTTTTGCTGGTCAACCACTCACTATTCTGAGCAGCACCGGACCTGTCCTAGTT
TTT
GAGAGGCTTCTATTTAATTTCAGCAAGGACAATAATTTTGACTATTTGGAGTTTCGCCTTTGGATTG
GC
CTGTGGTCCGCCTTCCTATGTCTCATTTTGGTAGCCACTGATGCCAGCTTCTTGGTTCAATACTTCAC
A
CGTTTCACGGAGGAGGGCTTTTCCTCTCTGATTAGCTTCATCTTTATCTATGATGCTTTCAAGAAGATG
ATC
AAGCTTGCAGATTACTACCCCATCAACTCCAACTTCAAAGTGGGCTACAACACTCTCTTTTCCTGTA
CC
TGTGTGCCACCTGACCCAGCTAATATCTCAATATCTAATGACACCACACTGGCCCCAGAGTATTTGCC
A
ACTATGTCTTCTACTGACATGTACCATAATACTACCTTTGACTGGGCATTTTTGTCGAAGAAGGAGTGT
TCA
AAATACGGAGGAAACCTCGTCGGGAACAACTGTAATTTTGTTCCTGATATCACACTCATGTCTTTTA
TC
CTCTTCTTGGGAACCTACACCTCTTCCATGGCTCTGAAAAAATTCAAAACTAGTCCTTATTTTCCAAC
C
ACAGCAAGAAAACTGATCAGTGATTTTGCCATTATCTTGTCCATTCTCATCTTTTGTGTAATAGATGCC
CTA
GTAGGCGTGGACACCCCAAAACTAATTGTGCCAAGTGAGTTCAAGCCAACAAGTCCAAACCGAGGTT
GG
TTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGT
C
ACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAACATAAACTCAAG
AAA
GGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCTC
TT
CCGTGGTATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGAC
T
TCTGCACCTGGAGAACAACCAAAGTTTCTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTT
ATT
CTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTGAAGTTTATACCCATGCCTGTACTCTATGGTG
TG
TTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAGCTGCTTCTGAT
G
CCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACT
TTC
CTGCAGGTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAG
TA
ATGATCTTGGCACTTGTAGCTGTCAGAAAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTT
C
CTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAGAAGAAAAAGAAAAAGAAGAAG
GGA
AGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATTC
CA
ATGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAAC
A
TTCCTTGAACGCCACACATCATGCTGA


Translation (1035 aa):
MSTENVEGKPSNLGERGRARSSTFLRVVQPMFNHSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDE
L
LAVDGQEMEWKETA
RWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVE
M
IVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDN
GSPAMTHRNLT
S
SSLNDISDKPEKDQ
LKNKFMKKLPRDAEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFL
F
ILLGPKGKAKSYHEIGRAIATLMSDE
VFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPP
K
SLPSSDK
RKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDA
L
NIQALSAILFIYLATVTNAITFGGLLGDATDNMQ
GVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLV
F
ERLLFNFS
KDNNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKM
I
KLADYYPINSNFKVGYNTLFSCTCVPPDP
ANISISNDTTLAPEYLPTMSSTDMYHNTTFDWAFLSKKEC
S
KYGGNLVGNNCNFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTT
ARKLISDFAIILSILIFCVIDA
L
VGVDTPKLIVPSEFK
PTSPNRGWFVPPFGENPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLK
K
GAGYHLDLFWVAILMVICSLMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGV
REQRVTGTLVF
I
LTGLSVFMAPILK
FIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFT
F
LQVLCLALLWILKSTVAAIIFPVM
ILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKK
G
SLDSDNDD
SDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser