NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32584.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32584.1 Public Homo sapiens 17 TOM1L2 15 105 74 CCDS HistoryNCBI Gene:146691Re-query CCDS DB by CCDS ID:32584.1Re-query CCDS DB by GeneID:146691

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 32584.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000581396 ENSP00000464297 Accepted alive Link to Ensembl Transcript Viewer:ENST00000581396Link to Ensembl Protein Viewer:ENSP00000464297Re-query CCDS DB by Nucleotide ID:ENST00000581396Re-query CCDS DB by Protein ID:ENSP00000464297
Original member Current member EBI,WTSI OTTHUMT00000131929 OTTHUMP00000065656 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000131929Link to Vega Protein Viewer:OTTHUMP00000065656Re-query CCDS DB by Nucleotide ID:OTTHUMT00000131929Re-query CCDS DB by Protein ID:OTTHUMP00000065656
Original member Current member NCBI NM_001033551.2 NP_001028723.1 Accepted alive Link to Nucleotide Sequence:NM_001033551.2Link to Protein Sequence:NP_001028723.1Re-query CCDS DB by Nucleotide ID:NM_001033551Re-query CCDS DB by Protein ID:NP_001028723Link to BLink:NP_001028723.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028723.1 457 Q6ZVM7-2 457 100% 0 0

Chromosomal Locations for CCDS 32584.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 17 (NC_000017.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

Chromosome Start Stop Links
17 17750949 17751097 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17752137 17752173 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17754207 17754266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17764790 17764865 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17766045 17766162 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17769610 17769733 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17770190 17770238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17772654 17772787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17782941 17783057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17786019 17786177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17787948 17788082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17801910 17801988 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17810761 17810845 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17875576 17875627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1374 nt):
ATGGAGTTCCTCCTGGGGAACCCGTTCAGCACACCAGTGGGGCAGTGCCTCGAAAAGGCAACAGATGGCT
CC
CTGCAAAGTGAGGATTGGACGTTGAATATGGAGATCTGTGACATCATCAATGAGACGGAGGAAGGGCC
A
AAGGATGCCATTCGAGCCCTGAAGAAGCGGCTCAACGGGAACCGGAACTACAGAGAGGTGATGCTGGCA
TTA
ACAGCATGGGCTGATGCCTTTCGAAGCAGTCCTGATCTCACCGGCGTTGTGCACATATATGAGGAGC
TG
AAGAGGAAAGGGGTTGAATTTCCCATGGCAGACTTGGACGCTCTGTCTCCCATACACACACCACAGCG
G
AGTGTCCCTGAAGTGGATCCAGCTGCGACCATGCCCAGGTCCCAATCACAGCAGAGGACAAGTGCTGGT
TCC
TATTCCTCGCCGCCTCCTGCTCCCTACTCCGCACCGCAGGCCCCAGCTCTGAGTGTGACTGGCCCCA
TC
ACAGCCAATTCAGAACAGATTGCCAGGCTGCGGAGTGAACTGGACGTCGTTCGAGGAAACACAAAAGT
C
ATGTCTGAGATGTTAACAGAAATGGTCCCTGGACAGGAGGATTCATCTGATCTGGAGTTGCTGCAGGAG
CTC
AACAGGACCTGTCGGGCCATGCAGCAGCGCATCGTGGAGCTCATCTCCCGCGTGTCCAATGAGGAGG
TC
ACCGAGGAGCTGCTGCATGTGAACGATGACCTCAACAACGTCTTCCTTCGATACGAGAGGTTCGAACG
A
TACAGGTCTGGCCGATCCGTTCAAAATGCCAGTAATGGAGTACTGAATGAAGTAACCGAAGACAACTTA
ATA
GACCTGGGGCCAGGGTCTCCAGCCGTGGTGAGCCCAATGGTGGGGAACACAGCGCCCCCATCTTCCC
TC
TCCTCCCAGCTTGCAGGCTTAGACTTGGGGACAGAGAGCGTCAGTGGCACCCTCAGTTCACTCCAGCA
A
TGTAATCCCCGTGACGGCTTTGACATGTTTGCCCAGACGAGAGGAAACTCCTTGGCTGAGCAGCGCAAG
AC
G
GTAACCTATGAGGATCCTCAGGCTGTCGGAGGACTTGCTTCTGCACTAGACAATCGAAAACAGAGTT
CA
GAAGGGATCCCCGTTGCGCAGCCATCTGTCATGGACGACATTGAGGTGTGGCTCAGGACCGACCTGAA
G
GGTGATGATCTGGAGGAGGGTGTCACAAGTGAAGAGTTTGATAAATTCCTTGAAGAAAGAGCCAAAGCT
GCT
GAAATGGTTCCCGACCTCCCCTCGCCCCCCATGGAGGCTCCTGCCCCAGCCTCAAACCCTTCTGGCC
GG
AAGAAGCCAGAGCGGTCAGAGGATGCCCTCTTCGCCCTGTGA


Translation (457 aa):
MEFLLGNPFSTPVGQCLEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLA
L
T
AWADAFRSSPDLTGVVHIYEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAG
S
YSSPPPAPYSAPQAPALSVTGPITANSEQ
IARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQE
L
NRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYE
RFERYRSGRSVQNASNGVLNEVTEDNL
I
DLGPGSPAVVSPMVGNTAPPSSLSSQLAGL
DLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRK
T
VTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKA
A
EMVPDLPSPPMEAPAPASNPSGRKKPERSEDALFAL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser