NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32579.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32579.1 Public Homo sapiens 17 FLCN 18 107 79 CCDS HistoryNCBI Gene:201163Re-query CCDS DB by CCDS ID:32579.1Re-query CCDS DB by GeneID:201163See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 32579.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000285071 ENSP00000285071 Accepted alive Link to Ensembl Transcript Viewer:ENST00000285071Link to Ensembl Protein Viewer:ENSP00000285071Re-query CCDS DB by Nucleotide ID:ENST00000285071Re-query CCDS DB by Protein ID:ENSP00000285071
Original member Current member EBI,WTSI OTTHUMT00000131577 OTTHUMP00000065503 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000131577Link to Vega Protein Viewer:OTTHUMP00000065503Re-query CCDS DB by Nucleotide ID:OTTHUMT00000131577Re-query CCDS DB by Protein ID:OTTHUMP00000065503
Original member Current member NCBI NM_144997.5 NP_659434.2 Accepted alive Link to Nucleotide Sequence:NM_144997.5Link to Protein Sequence:NP_659434.2Re-query CCDS DB by Nucleotide ID:NM_144997Re-query CCDS DB by Protein ID:NP_659434Link to BLink:NP_659434.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_659434.2 579 Q8NFG4-1 579 100% 0 0

Chromosomal Locations for CCDS 32579.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 17213655 17213856 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17214985 17215090 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17215185 17215316 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17216380 17216503 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17217069 17217182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17219019 17219209 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17221537 17221628 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17222501 17222661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17223922 17224143 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17226176 17226322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 17227889 17228137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1740 nt):
ATGAATGCCATCGTGGCTCTCTGCCACTTCTGCGAGCTCCACGGCCCCCGCACTCTCTTCTGCACGGAGG
TG
CTGCACGCCCCACTTCCTCAAGGGGATGGGAATGAGGACAGTCCTGGCCAGGGTGAGCAGGCGGAAGA
A
GAGGAAGGTGGCATTCAGATGAACAGTCGGATGCGTGCGCACAGCCCCGCAGAGGGGGCCAGCGTCGAG
TCC
AGCAGCCCGGGGCCCAAAAAGTCGGACATGTGCGAGGGCTGCCGGTCACTTGCTGCAGGGCACCCGG
GA
TATATCAGCCATGATAAAGAGACCTCCATTAAATACGTCAGCCACCAGCACCCCAGCCACCCCCAGCT
C
TTCAGCATTGTCCGCCAGGCCTGTGTCCGGAGCCTGAGCTGTGAGGTCTGCCCTGGCCGTGAAGGCCCC
ATC
TTCTTCGGAGATGAGCAGCACGGCTTTGTGTTCAGCCACACCTTCTTCATCAAGGACAGCCTGGCCA
GG
GGCTTCCAGCGCTGGTACAGCATCATCACCATCATGATGGACCGGATCTACCTCATCAACTCCTGGCC
C
TTCCTGCTGGGGAAGGTCCGGGGAATCATCGATGAGCTCCAGGGCAAGGCGCTCAAGGTGTTTGAGGCA
GAG
CAGTTTGGATGCCCACAGCGTGCTCAGAGGATGAACACAGCCTTCACGCCATTCCTACACCAGAGGA
AC
GGCAACGCCGCCCGCTCGCTGACATCGCTGACAAGTGATGACAACCTGTGGGCGTGCCTGCACACCTC
C
TTTGCCTGGCTCCTGAAGGCGTGTGGCAGCCGGCTGACCGAGAAGCTCCTGGAAGGTGCTCCGACCGAG
GAT
ACCTTGGTCCAGATGGAGAAGCTCGCTGATTTAGAAGAGGAATCAGAAAGCTGGGACAACTCTGAGG
CT
GAAGAGGAGGAGAAAGCCCCTGTGTTGCCAGAGAGTACAGAAGGGCGGGAGCTGACCCAGGGCCCGGC
A
GAGTCCTCCTCTCTCTCAGGCTGTGGGAGCTGGCAGCCCCGGAAGCTGCCAGTCTTCAAGTCCCTCCGG
CAC
ATGAGGCAGGTCCTGGGTGCCCCTTCTTTCCGCATGCTGGCCTGGCACGTTCTCATGGGGAACCAGG
TG
ATCTGGAAAAGCAGAGACGTGGACCTCGTCCAGTCAGCTTTTGAAGTACTTCGGACCATGCTTCCCGT
G
GGCTGCGTCCGCATCATCCCATACAGCAGCCAGTACGAGGAGGCCTATCGGTGCAACTTCCTGGGGCTC
AGC
CCGCACGTGCAGATCCCCCCCCACGTGCTCTCCTCAGAGTTTGCTGTCATCGTGGAGGTCCACGCAG
CC
GCACGTTCCACCCTCCACCCTGTGGGGTGTGAGGATGACCAGTCTCTCAGCAAGTACGAGTTTGTGGT
G
ACCAGTGGGAGCCCTGTAGCTGCAGACCGAGTGGGCCCCACCATCCTGAATAAGATTGAAGCGGCTCTG
ACC
AACCAGAACCTGTCTGTGGATGTGGTGGACCAGTGCCTCGTCTGCCTCAAGGAGGAGTGGATGAACA
AA
GTGAAGGTGCTTTTTAAGTTCACCAAGGTGGACAGTCGACCCAAAGAGGACACACAGAAGCTGCTGAG
C
ATCCTGGGTGCGTCCGAGGAGGACAATGTCAAGCTGCTGAAGTTCTGGATGACTGGCCTGAGCAAGACC
TAC
AAGTCACACCTCATGTCCACGGTCCGCAGCCCCACAGCCTCGGAGTCTCGGAACTGA


Translation (579 aa):
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRAHSPAEGASVE
S
SSPGPKKSDMCE
GCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGP
I
FFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRIYLINSWPFLLGKVRGIIDELQGKALK
VFEA
E
QFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSFA
WLLKACGSRLTEKLLEGAPTE
D
TLVQMEKLA
DLEEESESWDNSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLR
H
MRQ
VLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL
S
PHVQIPPHVLSS
EFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAAL
T
NQNLSVDVVDQCLVCLKEEWM
NKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKT
Y
KSHLMSTVRSPTASESRN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser