NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32552.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32552.1 Public Homo sapiens 17 KDM6B 17 106 76 CCDS HistoryNCBI Gene:23135Re-query CCDS DB by CCDS ID:32552.1Re-query CCDS DB by GeneID:23135

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 32552.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000254846 ENSP00000254846 Accepted alive Link to Ensembl Transcript Viewer:ENST00000254846Link to Ensembl Protein Viewer:ENSP00000254846Re-query CCDS DB by Nucleotide ID:ENST00000254846Re-query CCDS DB by Protein ID:ENSP00000254846
Original member Current member EBI,WTSI OTTHUMT00000440247 OTTHUMP00000258343 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000440247Link to Vega Protein Viewer:OTTHUMP00000258343Re-query CCDS DB by Nucleotide ID:OTTHUMT00000440247Re-query CCDS DB by Protein ID:OTTHUMP00000258343
Original member Current member NCBI NM_001080424.1 NP_001073893.1 Accepted alive Link to Nucleotide Sequence:NM_001080424.1Link to Protein Sequence:NP_001073893.1Re-query CCDS DB by Nucleotide ID:NM_001080424Re-query CCDS DB by Protein ID:NP_001073893Link to BLink:NP_001073893.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001073893.1 1682 O15054-1 1682 100% 0 0

Chromosomal Locations for CCDS 32552.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

Chromosome Start Stop Links
17 7845555 7845691 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7845872 7845970 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7846078 7846297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7846400 7846492 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7846579 7846740 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7846819 7847016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7847105 7847452 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7847546 7849728 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7849821 7849947 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7850072 7850177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7851021 7851226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7851330 7851394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7851478 7851549 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7851648 7851796 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7851951 7852065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7852149 7852336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7852495 7852636 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7853000 7853126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7853210 7853521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5049 nt):
ATGCATCGGGCAGTGGACCCTCCAGGGGCCCGCGCTGCACGGGAAGCCTTTGCCCTTGGGGGCCTGAGCT
GT
GCTGGGGCCTGGAGCTCCTGCCCGCCTCATCCCCCTCCTCGTAGCGCATGGCTGCCTGGAGGCAGATG
C
TCAGCCAGCATTGGGCAGCCCCCGCTTCCTGCTCCCCTACCCCCTTCACATGGCAGTAGTTCTGGGCAC
CCC
AGCAAACCATATTATGCTCCAGGGGCGCCCACTCCAAGACCCCTCCATGGGAAGCTGGAATCCCTGC
AT
GGCTGTGTGCAGGCATTGCTCCGGGAGCCAGCCCAGCCAGGGCTTTGGGAACAGCTTGGGCAACTGTA
C
GAGTCAGAGCACGATAGTGAGGAGGCCACACGCTGCTACCACAGCGCCCTTCGATACGGAGGAAGCTTC
GCT
GAGCTGGGGCCCCGCATTGGCCGACTGCAGCAGGCCCAGCTCTGGAACTTTCATACTGGCTCCTGCC
AG
CACCGAGCCAAGGTCCTGCCCCCACTGGAGCAAGTGTGGAACTTGCTACACCTTGAGCACAAACGGAA
C
TATGGAGCCAAGCGGGGAGGTCCCCCGGTGAAGCGAGCTGCTGAACCCCCAGTGGTGCAGCCTGTGCCT
CCT
GCAGCACTCTCAGGCCCCTCAGGGGAGGAGGGCCTCAGCCCTGGAGGCAAGCGAAGGAGAGGCTGCA
AC
TCTGAACAGACTGGCCTTCCCCCAGGGCTGCCACTGCCTCCACCACCATTACCACCACCACCACCACC
A
CCACCACCACCACCACCACCCCTGCCTGGCCTGGCTACCAGCCCCCCATTTCAGCTAACCAAGCCAGGG
CTG
TGGAGTACCCTGCATGGAGATGCCTGGGGCCCAGAGCGCAAGGGTTCAGCACCCCCAGAGCGCCAGG
AG
CAGCGGCACTCGCTGCCTCACCCATATCCATACCCAGCTCCAGCGTACACCGCGCACCCCCCTGGCCA
C
CGGCTGGTCCCGGCTGCTCCCCCAGGCCCAGGCCCCCGCCCCCCAGGAGCAGAGAGCCATGGCTGCCTG
CCT
GCCACCCGTCCCCCCGGAAGTGACCTTAGAGAGAGCAGAGTTCAGAGGTCGCGGATGGACTCCAGCG
TT
TCACCAGCAGCAACCACCGCCTGCGTGCCTTACGCCCCTTCCCGGCCCCCTGGCCTCCCCGGCACCAC
C
ACCAGCAGCAGCAGTAGCAGCAGCAGCAACACTGGTCTCCGGGGCGTGGAGCCGAACCCAGGCATTCCC
GGC
GCTGACCATTACCAAACTCCCGCGCTGGAGGTCTCTCACCATGGCCGCCTGGGGCCCTCGGCACACA
GC
AGTCGGAAACCGTTCTTGGGGGCTCCCGCTGCCACTCCCCACCTATCCCTGCCACCTGGACCTTCCTC
A
CCCCCTCCACCCCCCTGTCCCCGCCTCTTACGCCCCCCACCACCCCCTGCCTGGTTGAAGGGTCCGGCC
TGC
CGGGCAGCCCGAGAGGATGGAGAGATCTTAGAAGAGCTCTTCTTTGGGACTGAGGGACCCCCCCGCC
CT
GCCCCACCACCCCTCCCCCATCGCGAGGGCTTCTTGGGGCCTCCGGCCTCCCGCTTTTCTGTGGGCAC
T
CAGGATTCTCACACCCCTCCCACTCCCCCAACCCCAACCACCAGCAGTAGCAACAGCAACAGTGGCAGC
CAC
AGCAGCAGCCCTGCTGGGCCTGTGTCCTTTCCCCCACCACCCTATCTGGCCAGAAGTATAGACCCCC
TT
CCCCGGCCTCCCAGCCCAGCACAGAACCCCCAGGACCCACCTCTTGTACCCCTGACTCTTGCCCTGCC
T
CCAGCCCCTCCTTCCTCCTGCCACCAAAATACCTCAGGAAGCTTCAGGCGCCCGGAGAGCCCCCGGCCC
AGG
GTCTCCTTCCCAAAGACCCCCGAGGTGGGGCCGGGGCCACCCCCAGGCCCCCTGAGTAAAGCCCCCC
AG
CCTGTGCCGCCCGGGGTTGGGGAGCTGCCTGCCCGAGGCCCTCGACTCTTTGATTTTCCCCCCACTCC
G
CTGGAGGACCAGTTTGAGGAGCCAGCCGAATTCAAGATCCTACCTGATGGGCTGGCCAACATCATGAAG
ATG
CTGGACGAATCCATTCGCAAGGAAGAGGAACAGCAACAACACGAAGCAGGCGTGGCCCCCCAACCCC
CG
CTGAAGGAGCCCTTTGCATCTCTGCAGTCTCCTTTCCCCACCGACACAGCCCCCACCACTACTGCTCC
T
GCTGTCGCCGTCACCACCACCACCACCACCACCACCACCACCACGGCCACCCAGGAAGAGGAGAAGAAG
CCA
CCACCAGCCCTACCACCACCACCGCCTCTAGCCAAGTTCCCTCCACCCTCTCAGCCACAGCCACCAC
CA
CCCCCACCCCCCAGCCCGGCCAGCCTGCTCAAATCCTTGGCCTCCGTGCTGGAGGGACAAAAGTACTG
T
TATCGGGGGACTGGAGCAGCTGTTTCCACCCGGCCTGGGCCCTTGCCCACCACTCAGTATTCCCCTGGC
CCC
CCATCAGGTGCTACCGCCCTGCCGCCCACCTCAGCGGCCCCTAGCGCCCAGGGCTCCCCACAGCCCT
CT
GCTTCCTCGTCATCTCAGTTCTCTACCTCAGGCGGGCCCTGGGCCCGGGAGCGCAGGGCGGGCGAAGA
G
CCAGTCCCGGGCCCCATGACCCCCACCCAACCGCCCCCACCCCTATCTCTGCCCCCTGCTCGCTCTGAG
TCT
GAGGTGCTAGAAGAGATCAGCCGGGCTTGCGAGACCCTTGTGGAGCGGGTGGGCCGGAGTGCCACTG
AC
CCAGCCGACCCAGTGGACACAGCAGAGCCAGCGGACAGTGGGACTGAGCGACTGCTGCCCCCCGCACA
G
GCCAAGGAGGAGGCTGGCGGGGTGGCGGCAGTGTCAGGCAGCTGTAAGCGGCGACAGAAGGAGCATCAG
AAG
GAGCATCGGCGGCACAGGCGGGCCTGTAAGGACAGTGTGGGTCGTCGGCCCCGTGAGGGCAGGGCAA
AG
GCCAAGGCCAAGGTCCCCAAAGAAAAGAGCCGCCGGGTGCTGGGGAACCTGGACCTGCAGAGCGAGGA
G
ATCCAGGGTCGTGAGAAGTCCCGGCCCGATCTTGGCGGGGCCTCCAAGGCCAAGCCACCCACAGCTCCA
GCC
CCTCCATCAGCTCCTGCACCTTCTGCCCAGCCCACACCCCCGTCAGCCTCTGTCCCTGGAAAGAAGG
CT
CGGGAGGAAGCCCCAGGGCCACCGGGTGTCAGCCGGGCCGACATGCTGAAGCTGCGCTCACTTAGTGA
G
GGGCCCCCCAAGGAGCTGAAGATCCGGCTCATCAAGGTAGAGAGTGGTGACAAGGAGACCTTTATCGCC
TCT
GAGGTGGAAGAGCGGCGGCTGCGCATGGCAGACCTCACCATCAGCCACTGTGCTGCTGACGTCGTGC
GC
GCCAGCAGGAATGCCAAGGTGAAAGGGAAGTTTCGAGAGTCCTACCTTTCCCCTGCCCAGTCTGTGAA
A
CCGAAGATCAACACTGAGGAGAAGCTGCCCCGGGAAAAACTCAACCCCCCTACACCCAGCATCTATCTG
GAG
AGCAAACGGGATGCCTTCTCACCTGTCCTGCTGCAGTTCTGTACAGACCCTCGAAATCCCATCACAG
TG
ATCCGGGGCCTGGCGGGCTCCCTGCGGCTCAACTTGGGCCTCTTCTCCACCAAGACCCTGGTGGAAGC
G
AGTGGCGAACACACCGTGGAAGTTCGCACCCAGGTGCAGCAGCCCTCAGATGAGAACTGGGATCTGACA
GGC
ACTCGGCAGATCTGGCCTTGTGAGAGCTCCCGTTCCCACACCACCATTGCCAAGTACGCACAGTACC
AG
GCCTCATCCTTCCAGGAGTCTCTGCAGGAGGAGAAGGAGAGTGAGGATGAGGAGTCAGAGGAGCCAGA
C
AGCACCACTGGAACCCCTCCTAGCAGCGCACCAGACCCGAAGAACCATCACATCATCAAGTTTGGCACC
AAC
ATCGACTTGTCTGATGCTAAGCGGTGGAAGCCCCAGCTGCAGGAGCTGCTGAAGCTGCCCGCCTTCA
TG
CGGGTAACATCCACGGGCAACATGCTGAGCCACGTGGGCCACACCATCCTGGGCATGAACACGGTGCA
G
CTGTACATGAAGGTGCCCGGCAGCCGAACGCCAGGCCACCAGGAGAATAACAACTTCTGCTCCGTCAAC
ATC
AACATTGGCCCAGGCGACTGCGAGTGGTTCGCGGTGCACGAGCACTACTGGGAGACCATCAGCGCTT
TC
TGTGATCGGCACGGCGTGGACTACTTGACGGGTTCCTGGTGGCCAATCCTGGATGATCTCTATGCATC
C
AATATTCCTGTGTACCGCTTCGTGCAGCGACCCGGAGACCTCGTGTGGATTAATGCGGGGACTGTGCAC
TGG
GTGCAGGCCACCGGCTGGTGCAACAACATTGCCTGGAACGTGGGGCCCCTCACCGCCTATCAGTACC
AG
CTGGCCCTGGAACGATACGAGTGGAATGAGGTGAAGAACGTCAAATCCATCGTGCCCATGATTCACGT
G
TCATGGAACGTGGCTCGCACGGTCAAAATCAGCGACCCCGACTTGTTCAAGATGATCAAGTTCTGCCTG
CTG
CAGTCCATGAAGCACTGCCAGGTGCAACGCGAGAGCCTGGTGCGGGCAGGGAAGAAAATCGCTTACC
AG
GGCCGTGTCAAGGACGAGCCAGCCTACTACTGCAACGAGTGCGATGTGGAGGTGTTTAACATCCTGTT
C
GTGACAAGTGAGAATGGCAGCCGCAACACGTACCTGGTACACTGCGAGGGCTGTGCCCGGCGCCGCAGC
GCA
GGCCTGCAGGGCGTGGTGGTGCTGGAGCAGTACCGCACTGAGGAGCTGGCTCAGGCCTACGACGCCT
TC
ACGCTGGTGAGGGCCCGGCGGGCGCGCGGGCAGCGGAGGAGGGCACTGGGGCAGGCTGCAGGGACGGG
C
TTCGGGAGCCCGGCCGCGCCTTTCCCTGAGCCCCCGCCGGCTTTCTCCCCCCAGGCCCCAGCCAGCACG
TCG
CGATGA


Translation (1682 aa):
MHRAVDPPGARAAREAFALGGLSCAGAWSSCPPHPPPRSAWLPGGRCSASIGQPPLPAPLPPSHGSSSGH
P
SKPYYAP
GAPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEATRCYHSALRYGGSF
A
ELGPRIGRLQQ
AQLWNFHTGSCQHRAKVLPPLEQVWNLLHLEHKRNYGAKRGGPPVKRAAEPPVVQPVP
P
AALSGPSGEEGLSPGGKRRRGCNSEQ
TGLPPGLPLPPPPLPPPPPPPPPPPPPLPGLATSPPFQLTKPG
L
WSTLHGDAWGPERKGSAPPERQ
EQRHSLPHPYPYPAPAYTAHPPGHRLVPAAPPGPGPRPPGAESHGCL
P
ATRPPGSDLRESRVQRSRMDSSVSPAATTACVPYAPSRPPGLPGTTTSSSSSSSSNTGLRGVEPNPGI
P
G
ADHYQTPALEVSHHGRLGPSAHSSRKPFLGAPAATPHLSLPPGPSSPPPPPCPRLLRPPPPPAWLKGPA
C
RAAREDGEILEELFFGTEGPPRPAPPPLPHREGFLGPPASRFSVGTQDSHTPPTPPTPTTSSSNSNSGS
H
SSSPAGPVSFPPPPYLARSIDPLPRPPSPAQNPQDPPLVPLTLALPPAPPSSCHQNTSGSFRRPESPRP
R
VSFPKTPEVGPGPPPGPLSKAPQPVPPGVGELPARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMK
M
LDESIRKEEEQQQHEAGVAPQPPLKEPFASLQSPFPTDTAPTTTAPAVAVTTTTTTTTTTTATQEEEKK
P
PPALPPPPPLAKFPPPSQPQPPPPPPPSPASLLKSLASVLEGQKYCYRGTGAAVSTRPGPLPTTQYSPG
P
PSGATALPPTSAAPSAQGSPQPSASSSSQFSTSGGPWARERRAGEEPVPGPMTPTQPPPPLSLPPARSE
S
EVLEEISRACETLVERVGRSATDPADPVDTAEPADSGTERLLPPAQAKEEAGGVAAVSGSCKRRQKEHQ
K
EHRRHRRACKDSVGRRPREGRAKAKAKVPKEKSRRVLGNLDLQSEEIQGREKSRPDLGGASKAKPPTAP
A
PPSAPAPSAQPTPPSASVPGKKAREEAPGPPGVSRADMLKLRSLSEGPPKELKIRLIKVESGDKETFIA
S
EVEERRLRMADLTISHCAADVVRAS
RNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYL
E
SKRDAFSPVLLQFCTDPRNPITVIRGLAGSLRL
NLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLT
G
TRQIWPCESSRSHTTIAKYAQYQASSFQESLQ
EEKESEDEESEEPDSTTGTPPSSAPDPKNHHIIKFGT
N
IDLSDAK
RWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVN
I
NIGPGDCEWFAVHEHYWETISAFCD
RHGVDYLTGSWWPILDDLYASNIPVYRFVQRPGDLVWINAGTVH
W
VQATGWCNNIAWNVGPLT
AYQYQLALERYEWNEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCL
L
QSMKHCQVQRESLVRAGKKIAYQGRVKDEPAYYCNECD
VEVFNILFVTSENGSRNTYLVHCEGCARRRS
A
GLQGVVVLEQYRTEELAQAYDAFTLVRARRARGQRRRALGQAAGTGFGSPAAPFPEPPPAFSPQAPAST
S
R




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser