NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS31774.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
31774.1 Public Homo sapiens 12 LRRK2 17 106 76 CCDS HistoryNCBI Gene:120892Re-query CCDS DB by CCDS ID:31774.1Re-query CCDS DB by GeneID:120892

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 31774.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000298910 ENSP00000298910 Accepted alive Link to Ensembl Transcript Viewer:ENST00000298910Link to Ensembl Protein Viewer:ENSP00000298910Re-query CCDS DB by Nucleotide ID:ENST00000298910Re-query CCDS DB by Protein ID:ENSP00000298910
Original member Current member EBI,WTSI OTTHUMT00000277179 OTTHUMP00000179167 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000277179Link to Vega Protein Viewer:OTTHUMP00000179167Re-query CCDS DB by Nucleotide ID:OTTHUMT00000277179Re-query CCDS DB by Protein ID:OTTHUMP00000179167
Original member Current member NCBI NM_198578.3 NP_940980.3 Accepted alive Link to Nucleotide Sequence:NM_198578.3Link to Protein Sequence:NP_940980.3Re-query CCDS DB by Nucleotide ID:NM_198578Re-query CCDS DB by Protein ID:NP_940980Link to BLink:NP_940980.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_940980.3 2527 Q5S007 2527 99.9604% 0 1

Chromosomal Locations for CCDS 31774.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

Chromosome Start Stop Links
12 40225132 40225282 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40225555 40225640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40232274 40232383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40235626 40235714 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40237969 40238103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40240483 40240617 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40243550 40243681 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40249826 40249945 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40251232 40251374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40251465 40251544 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40252910 40253016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40257248 40257377 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40259480 40259604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40263789 40263901 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40274583 40274727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40274854 40274993 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40277888 40278016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40278091 40278261 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40283875 40284133 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40287351 40287539 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40293545 40293663 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40294845 40294914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40295427 40295644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40298243 40298493 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40299109 40299257 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40302789 40302882 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40303948 40304134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40305785 40305966 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40308467 40308696 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40309106 40309233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40310431 40310649 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40313972 40314173 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40315212 40315300 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40319988 40320175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40321034 40321188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40322035 40322181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40322319 40322510 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40323160 40323306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40328360 40328460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40334967 40335157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40340294 40340454 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40346753 40346923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40348409 40348509 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40351539 40351733 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40354299 40354492 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40356115 40356187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40359260 40359444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40363402 40363554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40364842 40365050 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40367006 40367077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 40367644 40367765 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7584 nt):
ATGGCTAGTGGCAGCTGTCAGGGGTGCGAAGAGGACGAGGAAACTCTGAAGAAGTTGATAGTCAGGCTGA
AC
AATGTCCAGGAAGGAAAACAGATAGAAACGCTGGTCCAAATCCTGGAGGATCTGCTGGTGTTCACGTA
C
TCCGAGCGCGCCTCCAAGTTATTTCAAGGCAAAAATATCCATGTGCCTCTGTTGATCGTCTTGGACTCC
TAT
ATGAGAGTCGCGAGTGTGCAGCAGGTGGGTTGGTCACTTCTGTGCAAATTAATAGAAGTCTGTCCAG
GT
ACAATGCAAAGCTTAATGGGACCCCAGGATGTTGGAAATGATTGGGAAGTCCTTGGTGTTCACCAATT
G
ATTCTTAAAATGCTAACAGTTCATAATGCCAGTGTAAACTTGTCAGTGATTGGACTGAAGACCTTAGAT
CTC
CTCCTAACTTCAGGTAAAATCACCTTGCTGATATTGGATGAAGAAAGTGATATTTTCATGTTAATTT
TT
GATGCCATGCACTCATTTCCAGCCAATGATGAAGTCCAGAAACTTGGATGCAAAGCTTTACATGTGCT
G
TTTGAGAGAGTCTCAGAGGAGCAACTGACTGAATTTGTTGAGAACAAAGATTATATGATATTGTTAAGT
GCG
TTAACAAATTTTAAAGATGAAGAGGAAATTGTGCTTCATGTGCTGCATTGTTTACATTCCCTAGCGA
TT
CCTTGCAATAATGTGGAAGTCCTCATGAGTGGCAATGTCAGGTGTTATAATATTGTGGTGGAAGCTAT
G
AAAGCATTCCCTATGAGTGAAAGAATTCAAGAAGTGAGTTGCTGTTTGCTCCATAGGCTTACATTAGGT
AAT
TTTTTCAATATCCTGGTATTAAACGAAGTCCATGAGTTTGTGGTGAAAGCTGTGCAGCAGTACCCAG
AG
AATGCAGCATTGCAGATCTCAGCGCTCAGCTGTTTGGCCCTCCTCACTGAGACTATTTTCTTAAATCA
A
GATTTAGAGGAAAAGAATGAGAATCAAGAGAATGATGATGAGGGGGAAGAAGATAAATTGTTTTGGCTG
GAA
GCCTGTTACAAAGCATTAACGTGGCATAGAAAGAACAAGCACGTGCAGGAGGCCGCATGCTGGGCAC
TA
AATAATCTCCTTATGTACCAAAACAGTTTACATGAGAAGATTGGAGATGAAGATGGCCATTTCCCAGC
T
CATAGGGAAGTGATGCTCTCCATGCTGATGCATTCTTCATCAAAGGAAGTTTTCCAGGCATCTGCGAAT
GCA
TTGTCAACTCTCTTAGAACAAAATGTTAATTTCAGAAAAATACTGTTATCAAAAGGAATACACCTGA
AT
GTTTTGGAGTTAATGCAGAAGCATATACATTCTCCTGAAGTGGCTGAAAGTGGCTGTAAAATGCTAAA
T
CATCTTTTTGAAGGAAGCAACACTTCCCTGGATATAATGGCAGCAGTGGTCCCCAAAATACTAACAGTT
ATG
AAACGTCATGAGACATCATTACCAGTGCAGCTGGAGGCGCTTCGAGCTATTTTACATTTTATAGTGC
CT
GGCATGCCAGAAGAATCCAGGGAGGATACAGAATTTCATCATAAGCTAAATATGGTTAAAAAACAGTG
T
TTCAAGAATGATATTCACAAACTGGTCCTAGCAGCTTTGAACAGGTTCATTGGAAATCCTGGGATTCAG
AAA
TGTGGATTAAAAGTAATTTCTTCTATTGTACATTTTCCTGATGCATTAGAGATGTTATCCCTGGAAG
GT
GCTATGGATTCAGTGCTTCACACACTGCAGATGTATCCAGATGACCAAGAAATTCAGTGTCTGGGTTT
A
AGTCTTATAGGATACTTGATTACAAAGAAGAATGTGTTCATAGGAACTGGACATCTGCTGGCAAAAATT
CTG
GTTTCCAGCTTATACCGATTTAAGGATGTTGCTGAAATACAGACTAAAGGATTTCAGACAATCTTAG
CA
ATCCTCAAATTGTCAGCATCTTTTTCTAAGCTGCTGGTGCATCATTCATTTGACTTAGTAATATTCCA
T
CAAATGTCTTCCAATATCATGGAACAAAAGGATCAACAGTTTCTAAACCTCTGTTGCAAGTGTTTTGCA
AAA
GTAGCTATGGATGATTACTTAAAAAATGTGATGCTAGAGAGAGCGTGTGATCAGAATAACAGCATCA
TG
GTTGAATGCTTGCTTCTATTGGGAGCAGATGCCAATCAAGCAAAGGAGGGATCTTCTTTAATTTGTCA
G
GTATGTGAGAAAGAGAGCAGTCCCAAATTGGTGGAACTCTTACTGAATAGTGGATCTCGTGAACAAGAT
GTA
CGAAAAGCGTTGACGATAAGCATTGGGAAAGGTGACAGCCAGATCATCAGCTTGCTCTTAAGGAGGC
TG
GCCCTGGATGTGGCCAACAATAGCATTTGCCTTGGAGGATTTTGTATAGGAAAAGTTGAACCTTCTTG
G
CTTGGTCCTTTATTTCCAGATAAGACTTCTAATTTAAGGAAACAAACAAATATAGCATCTACACTAGCA
AGA
ATGGTGATCAGATATCAGATGAAAAGTGCTGTGGAAGAAGGAACAGCCTCAGGCAGCGATGGAAATT
TT
TCTGAAGATGTGCTGTCTAAATTTGATGAATGGACCTTTATTCCTGACTCTTCTATGGACAGTGTGTT
T
GCTCAAAGTGATGACCTGGATAGTGAAGGAAGTGAAGGCTCATTTCTTGTGAAAAAGAAATCTAATTCA
ATT
AGTGTAGGAGAATTTTACCGAGATGCCGTATTACAGCGTTGCTCACCAAATTTGCAAAGACATTCCA
AT
TCCTTGGGGCCCATTTTTGATCATGAAGATTTACTGAAGCGAAAAAGAAAAATATTATCTTCAGATGA
T
TCACTCAGGTCATCAAAACTTCAATCCCATATGAGGCATTCAGACAGCATTTCTTCTCTGGCTTCTGAG
AGA
GAATATATTACATCACTAGACCTTTCAGCAAATGAACTAAGAGATATTGATGCCCTAAGCCAGAAAT
GC
TGTATAAGTGTTCATTTGGAGCATCTTGAAAAGCTGGAGCTTCACCAGAATGCACTCACGAGCTTTCC
A
CAACAGCTATGTGAAACTCTGAAGAGTTTGACACATTTGGACTTGCACAGTAATAAATTTACATCATTT
CCT
TCTTATTTGTTGAAAATGAGTTGTATTGCTAATCTTGATGTCTCTCGAAATGACATTGGACCCTCAG
TG
GTTTTAGATCCTACAGTGAAATGTCCAACTCTGAAACAGTTTAACCTGTCATATAACCAGCTGTCTTT
T
GTACCTGAGAACCTCACTGATGTGGTAGAGAAACTGGAGCAGCTCATTTTAGAAGGAAATAAAATATCA
GGG
ATATGCTCCCCCTTGAGACTGAAGGAACTGAAGATTTTAAACCTTAGTAAGAACCACATTTCATCCC
TA
TCAGAGAACTTTCTTGAGGCTTGTCCTAAAGTGGAGAGTTTCAGTGCCAGAATGAATTTTCTTGCTGC
T
ATGCCTTTCTTGCCTCCTTCTATGACAATCCTAAAATTATCTCAGAACAAATTTTCCTGTATTCCAGAA
GCA
ATTTTAAATCTTCCACACTTGCGGTCTTTAGATATGAGCAGCAATGATATTCAGTACCTACCAGGTC
CC
GCACACTGGAAATCTTTGAACTTAAGGGAACTCTTATTTAGCCATAATCAGATCAGCATCTTGGACTT
G
AGTGAAAAAGCATATTTATGGTCTAGAGTAGAGAAACTGCATCTTTCTCACAATAAACTGAAAGAGATT
CCT
CCTGAGATTGGCTGTCTTGAAAATCTGACATCTCTGGATGTCAGTTACAACTTGGAACTAAGATCCT
TT
CCCAATGAAATGGGGAAATTAAGCAAAATATGGGATCTTCCTTTGGATGAACTGCATCTTAACTTTGA
T
TTTAAACATATAGGATGTAAAGCCAAAGACATCATAAGGTTTCTTCAACAGCGATTAAAAAAGGCTGTG
CCT
TATAACCGAATGAAACTTATGATTGTGGGAAATACTGGGAGTGGTAAAACCACCTTATTGCAGCAAT
TA
ATGAAAACCAAGAAATCAGATCTTGGAATGCAAAGTGCCACAGTTGGCATAGATGTGAAAGACTGGCC
T
ATCCAAATAAGAGACAAAAGAAAGAGAGATCTCGTCCTAAATGTGTGGGATTTTGCAGGTCGTGAGGAA
TTC
TATAGTACTCATCCCCATTTTATGACGCAGCGAGCATTGTACCTTGCTGTCTATGACCTCAGCAAGG
GA
CAGGCTGAAGTTGATGCCATGAAGCCTTGGCTCTTCAATATAAAGGCTCGCGCTTCTTCTTCCCCTGT
G
ATTCTCGTTGGCACACATTTGGATGTTTCTGATGAGAAGCAACGCAAAGCCTGCATGAGTAAAATCACC
AAG
GAACTCCTGAATAAGCGAGGGTTCCCTGCCATACGAGATTACCACTTTGTGAATGCCACCGAGGAAT
CT
GATGCTTTGGCAAAACTTCGGAAAACCATCATAAACGAGAGCCTTAATTTCAAGATCCGAGATCAGCT
T
GTTGTTGGACAGCTGATTCCAGACTGCTATGTAGAACTTGAAAAAATCATTTTATCGGAGCGTAAAAAT
GTG
CCAATTGAATTTCCCGTAATTGACCGGAAACGATTATTACAACTAGTGAGAGAAAATCAGCTGCAGT
TA
GATGAAAATGAGCTTCCTCACGCAGTTCACTTTCTAAATGAATCAGGAGTCCTTCTTCATTTTCAAGA
C
CCAGCACTGCAGTTAAGTGACTTGTACTTTGTGGAACCCAAGTGGCTTTGTAAAATCATGGCACAGATT
TTG
ACAGTGAAAGTGGAAGGTTGTCCAAAACACCCTAAGGGCATTATTTCGCGTAGAGATGTGGAAAAAT
TT
CTTTCAAAAAAAAGGAAATTTCCAAAGAACTACATGTCACAGTATTTTAAGCTCCTAGAAAAATTCCA
G
ATTGCTTTGCCAATAGGAGAAGAATATTTGCTGGTTCCAAGCAGTTTGTCTGACCACAGGCCTGTGATA
GAG
CTTCCCCATTGTGAGAACTCTGAAATTATCATCCGACTATATGAAATGCCTTATTTTCCAATGGGAT
TT
TGGTCAAGATTAATCAATCGATTACTTGAGATTTCACCTTACATGCTTTCAGGGAGAGAACGAGCACT
T
CGCCCAAACAGAATGTATTGGCGACAAGGCATTTACTTAAATTGGTCTCCTGAAGCTTATTGTCTGGTA
GGA
TCTGAAGTCTTAGACAATCATCCAGAGAGTTTCTTAAAAATTACAGTTCCTTCTTGTAGAAAAGGCT
GT
ATTCTTTTGGGCCAAGTTGTGGACCACATTGATTCTCTCATGGAAGAATGGTTTCCTGGGTTGCTGGA
G
ATTGATATTTGTGGTGAAGGAGAAACTCTGTTGAAGAAATGGGCATTATATAGTTTTAATGATGGTGAA
GAA
CATCAAAAAATCTTACTTGATGACTTGATGAAGAAAGCAGAGGAAGGAGATCTCTTAGTAAATCCAG
AT
CAACCAAGGCTCACCATTCCAATATCTCAGATTGCCCCTGACTTGATTTTGGCTGACCTGCCTAGAAA
T
ATTATGTTGAATAATGATGAGTTGGAATTTGAACAAGCTCCAGAGTTTCTCCTAGGTGATGGCAGTTTT
GGA
TCAGTTTACCGAGCAGCCTATGAAGGAGAAGAAGTGGCTGTGAAGATTTTTAATAAACATACATCAC
TC
AGGCTGTTAAGACAAGAGCTTGTGGTGCTTTGCCACCTCCACCACCCCAGTTTGATATCTTTGCTGGC
A
GCTGGGATTCGTCCCCGGATGTTGGTGATGGAGTTAGCCTCCAAGGGTTCCTTGGATCGCCTGCTTCAG
CAG
GACAAAGCCAGCCTCACTAGAACCCTACAGCACAGGATTGCACTCCACGTAGCTGATGGTTTGAGAT
AC
CTCCACTCAGCCATGATTATATACCGAGACCTGAAACCCCACAATGTGCTGCTTTTCACACTGTATCC
C
AATGCTGCCATCATTGCAAAGATTGCTGACTACGGCATTGCTCAGTACTGCTGTAGAATGGGGATAAAA
ACA
TCAGAGGGCACACCAGGGTTTCGTGCACCTGAAGTTGCCAGAGGAAATGTCATTTATAACCAACAGG
CT
GATGTTTATTCATTTGGTTTACTACTCTATGACATTTTGACAACTGGAGGTAGAATAGTAGAGGGTTT
G
AAGTTTCCAAATGAGTTTGATGAATTAGAAATACAAGGAAAATTACCTGATCCAGTTAAAGAATATGGT
TGT
GCCCCATGGCCTATGGTTGAGAAATTAATTAAACAGTGTTTGAAAGAAAATCCTCAAGAAAGGCCTA
CT
TCTGCCCAGGTCTTTGACATTTTGAATTCAGCTGAATTAGTCTGTCTGACGAGACGCATTTTATTACC
T
AAAAACGTAATTGTTGAATGCATGGTTGCTACACATCACAACAGCAGGAATGCAAGCATTTGGCTGGGC
TGT
GGGCACACCGACAGAGGACAGCTCTCATTTCTTGACTTAAATACTGAAGGATACACTTCTGAGGAAG
TT
GCTGATAGTAGAATATTGTGCTTAGCCTTGGTGCATCTTCCTGTTGAAAAGGAAAGCTGGATTGTGTC
T
GGGACACAGTCTGGTACTCTCCTGGTCATCAATACCGAAGATGGGAAAAAGAGACATACCCTAGAAAAG
ATG
ACTGATTCTGTCACTTGTTTGTATTGCAATTCCTTTTCCAAGCAAAGCAAACAAAAAAATTTTCTTT
TG
GTTGGAACCGCTGATGGCAAGTTAGCAATTTTTGAAGATAAGACTGTTAAGCTTAAAGGAGCTGCTCC
T
TTGAAGATACTAAATATAGGAAATGTCAGTACTCCATTGATGTGTTTGAGTGAATCCACAAATTCAACG
GAA
AGAAATGTAATGTGGGGAGGATGTGGCACAAAGATTTTCTCCTTTTCTAATGATTTCACCATTCAGA
AA
CTCATTGAGACAAGAACAAGCCAACTGTTTTCTTATGCAGCTTTCAGTGATTCCAACATCATAACAGT
G
GTGGTAGACACTGCTCTCTATATTGCTAAGCAAAATAGCCCTGTTGTGGAAGTGTGGGATAAGAAAACT
GAA
AAACTCTGTGGACTAATAGACTGCGTGCACTTTTTAAGGGAGGTAATGGTAAAAGAAAACAAGGAAT
CA
AAACACAAAATGTCTTATTCTGGGAGAGTGAAAACCCTCTGCCTTCAGAAGAACACTGCTCTTTGGAT
A
GGAACTGGAGGAGGCCATATTTTACTCCTGGATCTTTCAACTCGTCGACTTATACGTGTAATTTACAAC
TTT
TGTAATTCGGTCAGAGTCATGATGACAGCACAGCTAGGAAGCCTTAAAAATGTCATGCTGGTATTGG
GC
TACAACCGGAAAAATACTGAAGGTACACAAAAGCAGAAAGAGATACAATCTTGCTTGACCGTTTGGGA
C
ATCAATCTTCCACATGAAGTGCAAAATTTAGAAAAACACATTGAAGTGAGAAAAGAATTAGCTGAAAAA
ATG
AGACGAACATCTGTTGAGTAA


Translation (2527 aa):
MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDS
Y
MRVASVQQ
VGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLD
L
LLTS
GKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLS
A
LTNFKDEEEIVLHVLHCLHSLAIP
CNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLG
N
FFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALL
TETIFLNQDLEEKNENQENDDEGEEDKLFWL
E
ACYKALTWHRKNKHVQ
EAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN
A
LSTLLEQN
VNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTV
M
KRHETSLPVQLEALRAILHFIVP
GMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQ
K
CGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ
EIQCLGLSLIGYLITKKNVFIGTGHLLAKI
L
VSSLYRFKDVAEIQTK
GFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFA
K
VAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQ
VCEKESSPKLVELLLNSGSREQD
V
RKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQT
NIASTLA
R
MVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSE
GSEGSFLVKKKSNS
I
SVGEFYRDAVLQRCSPNLQRHSNSL
GPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASE
R
EYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCE
TLKSLTHLDLHSNKFTSF
P
SYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILE
GNKIS
G
ICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFL
AAMPFLPPSMTILKLSQNKFSCIPE
A
ILNLP
HLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEI
P
PEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDII
RFLQQRLKKAV
P
YNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFA
GREE
F
YSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIK
ARASSSPVILVGTHLDVSDEKQRKACMSKIT
K
ELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFK
IRDQLVVGQLIPDCYVELEKIILSERKN
V
PIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNES
GVLLHFQDPALQLSDLYFVEPKWLCKIMAQI
L
TVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPS
SLSDHRPVI
E
LPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGR
ERALRPNRMYWRQGIYLNWSPEAYCLV
G
SEVLDNHPESFLKITVPSCRK
GCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGE
E
HQKILLDDLMKKAEE
GDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSF
G
SVYRAAYEGEEVAVKIFNKHTSLRLLRQ
ELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQ
Q
DKASLTRTLQHRIALHVADGL
RYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIK
T
SEGTP
GFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG
C
APWPMVEKLIKQCLKENPQERPTSAQ
VFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLG
C
GHTDRGQLSFLDLNTEGYTSE
EVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEK
M
TDSVTCLYCNSFSKQ
SKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNST
E
RNVMWGGCGTKIFSFSNDFTIQKLIETRTSQ
LFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKT
E
KLCGLIDCVHFL
REVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYN
F
CNSVRVMMTAQL
GSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK
M
RRTSVE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser