NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS2890.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2890.1 Public Homo sapiens 3 PDHB 15 105 74 CCDS HistoryNCBI Gene:5162Re-query CCDS DB by CCDS ID:2890.1Re-query CCDS DB by GeneID:5162

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 2890.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000302746 ENSP00000307241 Accepted alive Link to Ensembl Transcript Viewer:ENST00000302746Link to Ensembl Protein Viewer:ENSP00000307241Re-query CCDS DB by Nucleotide ID:ENST00000302746Re-query CCDS DB by Protein ID:ENSP00000307241
Original member Current member EBI,WTSI OTTHUMT00000353558 OTTHUMP00000214202 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000353558Link to Vega Protein Viewer:OTTHUMP00000214202Re-query CCDS DB by Nucleotide ID:OTTHUMT00000353558Re-query CCDS DB by Protein ID:OTTHUMP00000214202
Original member Current member NCBI NM_000925.3 NP_000916.2 Accepted alive Link to Nucleotide Sequence:NM_000925.3Link to Protein Sequence:NP_000916.2Re-query CCDS DB by Nucleotide ID:NM_000925Re-query CCDS DB by Protein ID:NP_000916Link to BLink:NP_000916.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000916.2 359 P11177-1 359 100% 0 0

Chromosomal Locations for CCDS 2890.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 3 (NC_000003.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 58413761 58413906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58414200 58414341 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58415435 58415526 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58415855 58415965 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58416384 58416669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58417320 58417355 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58417458 58417520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58417604 58417711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58419358 58419411 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58419495 58419536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGGCGGCGGTGTCTGGCTTGGTGCGGAGACCCCTTCGGGAGGTCTCCGGGCTGCTGAAGAGGCGCTTTC
AC
TGGACCGCGCCGGCTGCGCTGCAGGTGACAGTTCGTGATGCTATAAATCAGGGTATGGATGAGGAGCT
G
GAAAGAGATGAGAAGGTATTTCTGCTTGGAGAAGAAGTTGCCCAGTATGATGGGGCATACAAGGTTAGT
CGA
GGGCTGTGGAAGAAATATGGAGACAAGAGGATTATTGACACTCCCATATCAGAGATGGGCTTTGCTG
GA
ATTGCTGTAGGTGCAGCTATGGCTGGGTTGCGGCCCATTTGTGAATTTATGACCTTCAATTTCTCCAT
G
CAAGCCATTGACCAGGTTATAAACTCAGCTGCCAAGACCTACTACATGTCTGGTGGCCTTCAGCCTGTG
CCT
ATAGTCTTCAGAGGGCCCAATGGTGCCTCAGCAGGTGTAGCTGCCCAGCACTCACAGTGCTTTGCTG
CC
TGGTATGGGCACTGCCCAGGCTTAAAGGTGGTCAGTCCCTGGAATTCAGAGGATGCTAAAGGACTTAT
T
AAATCAGCCATTCGGGATAACAATCCAGTGGTGGTGCTAGAGAATGAATTGATGTATGGGGTTCCTTTT
GAA
TTTCCTCCGGAAGCTCAGTCAAAAGATTTTCTGATTCCTATTGGAAAAGCCAAAATAGAAAGGCAAG
GA
ACACATATAACTGTGGTTTCCCATTCAAGACCTGTGGGCCACTGCTTAGAAGCTGCAGCAGTGCTATC
T
AAAGAAGGAGTTGAATGTGAGGTGATAAATATGCGTACCATTAGACCAATGGACATGGAAACCATAGAA
GCC
AGTGTCATGAAGACAAATCATCTTGTAACTGTGGAAGGAGGCTGGCCACAGTTTGGAGTAGGAGCTG
AA
ATCTGTGCCAGGATCATGGAAGGTCCTGCGTTCAATTTCCTGGATGCTCCTGCTGTTCGTGTCACTGG
T
GCTGATGTCCCTATGCCTTATGCAAAGATTCTAGAGGACAACTCTATACCTCAGGTCAAAGACATCATA
TTT
GCAATAAAGAAAACATTAAATATTTAG


Translation (359 aa):
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYKVS
R
GLWKKYGDKRIIDTPISE
MGFAGIAVGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPV
P
IVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNP
VVVLENELMYGVPF
E
FPPEAQSKDFLIPIGKAKIERQ
GTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIE
A
SVMKTNHLVTVEGGWPQFGVGAEICARIME
GPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDII
F
AIKKTLNI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser