NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS2788.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
2788.1 Public Homo sapiens 3 QARS 15 105 74 CCDS HistoryNCBI Gene:5859Re-query CCDS DB by CCDS ID:2788.1Re-query CCDS DB by GeneID:5859

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 2788.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000306125 ENSP00000307567 Accepted alive Link to Ensembl Transcript Viewer:ENST00000306125Link to Ensembl Protein Viewer:ENSP00000307567Re-query CCDS DB by Nucleotide ID:ENST00000306125Re-query CCDS DB by Protein ID:ENSP00000307567
Original member Current member EBI,WTSI OTTHUMT00000345689 OTTHUMP00000210569 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000345689Link to Vega Protein Viewer:OTTHUMP00000210569Re-query CCDS DB by Nucleotide ID:OTTHUMT00000345689Re-query CCDS DB by Protein ID:OTTHUMP00000210569
Original member Current member NCBI NM_005051.2 NP_005042.1 Accepted alive Link to Nucleotide Sequence:NM_005051.2Link to Protein Sequence:NP_005042.1Re-query CCDS DB by Nucleotide ID:NM_005051Re-query CCDS DB by Protein ID:NP_005042Link to BLink:NP_005042.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005042.1 775 P47897-1 775 100% 0 0

Chromosomal Locations for CCDS 2788.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 3 (NC_000003.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 49133462 49133512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49135425 49135550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49135625 49135691 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49135786 49135913 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49136033 49136125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49136318 49136422 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49136543 49136686 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49136777 49136864 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49136943 49137080 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49137194 49137286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49137394 49137524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49137623 49137731 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49137813 49137891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49138008 49138107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49138788 49138874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49139053 49139138 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49139261 49139332 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49139638 49139698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49139852 49139905 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49140778 49140842 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49141064 49141139 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49141296 49141405 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49141757 49141904 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 49142050 49142166 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2328 nt):
ATGGCGGCTCTAGACTCCCTGTCGCTCTTCACTAGCCTCGGCCTGAGCGAGCAGAAGGCCCGCGAGACGC
TC
AAGAACTCGGCTCTGAGCGCGCAGCTGCGCGAGGCCGCTACTCAGGCTCAGCAGACCCTGGGTTCCAC
C
ATTGACAAAGCTACCGGGATCCTGTTATATGGCTTGGCCTCCCGACTCAGGGATACCCGGCGTCTCTCC
TTC
CTTGTAAGCTACATAGCCAGTAAGAAGATCCACACTGAGCCCCAGCTAAGCGCTGCCCTTGAGTATG
TG
CGGAGTCACCCCTTGGACCCCATCGACACTGTGGACTTCGAGCGGGAATGTGGCGTGGGTGTCATTGT
G
ACCCCAGAGCAGATTGAGGAGGCTGTGGAGGCTGCTATTAACAGGCACCGGCCCCAGCTCCTGGTGGAA
CGT
TACCATTTCAACATGGGGCTGCTGATGGGAGAGGCTCGGGCTGTGCTGAAGTGGGCAGATGGCAAAA
TG
ATCAAGAATGAAGTGGACATGCAGGTCCTCCACCTTCTGGGCCCCAAGTTGGAGGCTGATCTGGAGAA
G
AAGTTCAAGGTGGCAAAAGCTCGGCTAGAAGAAACAGACCGGAGGACGGCAAAGGATGTGGTGGAGAAT
G
GC
GAGACTGCTGACCAGACCCTGTCTCTGATGGAGCAGCTCCGGGGGGAGGCCCTTAAGTTCCACAAGC
CT
GGTGAGAACTACAAGACCCCAGGCTATGTGGTCACTCCACACACCATGAATCTACTAAAGCAGCACCT
G
GAGATTACTGGTGGGCAGGTACGTACCCGGTTCCCGCCAGAACCCAATGGAATCCTGCATATTGGACAT
GCC
AAAGCCATCAATTTCAACTTTGGCTATGCCAAGGCCAACAATGGCATCTGTTTTCTGCGTTTTGATG
AC
ACCAACCCTGAGAAGGAGGAAGCAAAGTTCTTCACGGCCATCTGTGACATGGTAGCCTGGCTAGGCTA
C
ACACCTTACAAAGTCACATATGCGTCTGACTATTTTGACCAGCTATATGCGTGGGCTGTGGAGCTCATC
CGC
AGGGGTCTGGCTTATGTGTGCCACCAGCGAGGAGAGGAGCTCAAAGGCCATAATACTCTGCCTTCAC
CC
TGGAGAGACCGTCCCATGGAGGAGTCACTGCTGCTCTTTGAGGCAATGCGCAAGGGCAAGTTTTCAGA
G
GGCGAGGCCACACTACGGATGAAGCTGGTGATGGAGGATGGCAAGATGGACCCTGTAGCCTATCGAGTC
AAG
TATACACCACACCACCGCACAGGGGACAAATGGTGCATCTATCCCACCTACGACTACACACACTGCC
TC
TGTGACTCCATCGAGCACATCACTCACTCACTCTGCACCAAGGAATTCCAGGCCCGACGCTCTTCCTA
C
TTCTGGCTTTGCAATGCACTGGACGTCTATTGCCCTGTGCAGTGGGAGTATGGCCGCCTCAACCTGCAC
TAT
GCTGTTGTCTCTAAGAGGAAGATCCTCCAGCTTGTAGCAACTGGTGCTGTGCGGGACTGGGATGACC
CA
CGGCTCTTTACACTCACGGCCCTGCGACGGCGGGGCTTCCCACCTGAGGCCATCAACAACTTCTGTGC
C
CGGGTGGGAGTGACTGTGGCACAAACCACAATGGAGCCACATCTTCTAGAAGCCTGTGTGCGTGATGTG
CTG
AATGACACAGCCCCACGAGCCATGGCTGTGCTGGAGTCACTACGGGTCATCATCACCAACTTTCCTG
CT
GCCAAGTCCTTGGACATCCAGGTGCCCAACTTCCCAGCTGATGAGACCAAAGGCTTCCATCAGGTTCC
C
TTTGCACCCATTGTCTTCATTGAGAGGACTGACTTCAAGGAGGAGCCAGAGCCAGGATTTAAGCGCCTG
GCT
TGGGGCCAGCCTGTGGGCCTGAGGCATACAGGCTACGTCATTGAGCTGCAGCATGTTGTCAAGGGCC
CC
AGTGGTTGTGTAGAGAGTCTGGAGGTGACCTGCAGACGGGCAGATGCTGGAGAGAAGCCAAAGGCCTT
T
ATTCACTGGGTGTCACAGCCTTTGATGTGTGAGGTTCGCCTCTATGAGCGACTATTCCAGCACAAGAAC
CCT
GAAGATCCTACTGAGGTGCCTGGTGGATTTTTAAGTGACCTGAACCTGGCATCACTACACGTGGTGG
AT
GCAGCATTAGTGGACTGCTCTGTGGCCCTGGCAAAACCCTTCGACAAGTTCCAGTTTGAGCGTCTTGG
A
TATTTCTCCGTGGATCCAGACAGCCATCAGGGAAAGCTTGTCTTTAACCGAACTGTCACACTGAAGGAA
GAC
CCAGGAAAGGTGTGA


Translation (775 aa):
MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLRDTRRLS
F
LVSYIASKKIHTEPQLS
AALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINRHRPQLLVE
R
YHFNMGLLM
GEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADLEKKFKVAKARLEETDRRTAKDVVEN
G
ETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQVRTRFPPEPNGILHIGH
A
KAINFNFGYAK
ANNGICFLRFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELI
R
RGLAYVCHQRGEELKGHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRV
K
YTPHHRTGDK
WCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLH
Y
AVVSKRKILQLVATGAV
RDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVRDV
L
NDTAPRAMAVLESLRVIITNFPAAK
SLDIQVPNFPADETKGFHQVPFAPIVFIERTDFKEEPEPGFKRL
A
WGQPVGLRHTGYVIELQHVVK
GPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKN
P
EDPTEVPGGFLSDLNL
ASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKE
D
PGKV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser