NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1874.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1874.1 Public Homo sapiens 2 MDH1 15 105 74 CCDS HistoryNCBI Gene:4190Re-query CCDS DB by CCDS ID:1874.1Re-query CCDS DB by GeneID:4190

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 1874.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000233114 ENSP00000233114 Accepted alive Link to Ensembl Transcript Viewer:ENST00000233114Link to Ensembl Protein Viewer:ENSP00000233114Re-query CCDS DB by Nucleotide ID:ENST00000233114Re-query CCDS DB by Protein ID:ENSP00000233114
Original member Current member EBI,WTSI OTTHUMT00000251687 OTTHUMP00000159898 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000251687Link to Vega Protein Viewer:OTTHUMP00000159898Re-query CCDS DB by Nucleotide ID:OTTHUMT00000251687Re-query CCDS DB by Protein ID:OTTHUMP00000159898
Original member Current member NCBI NM_005917.3 NP_005908.1 Accepted alive Link to Nucleotide Sequence:NM_005917.3Link to Protein Sequence:NP_005908.1Re-query CCDS DB by Nucleotide ID:NM_005917Re-query CCDS DB by Protein ID:NP_005908Link to BLink:NP_005908.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005908.1 334 P40925-1 334 100% 0 0

Chromosomal Locations for CCDS 1874.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 2 (NC_000002.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 63816178 63816180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 63821622 63821720 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 63822557 63822653 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 63824533 63824708 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 63826304 63826426 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 63831830 63832006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 63832414 63832527 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 63833073 63833162 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 63833996 63834121 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1005 nt):
ATGTCTGAACCAATCAGAGTCCTTGTGACTGGAGCAGCTGGTCAAATTGCATATTCACTGCTGTACAGTA
TT
GGAAATGGATCTGTCTTTGGTAAAGATCAGCCTATAATTCTTGTGCTGTTGGATATCACCCCCATGAT
G
GGTGTCCTGGACGGTGTCCTAATGGAACTGCAAGACTGTGCCCTTCCCCTCCTGAAAGATGTCATCGCA
ACA
GATAAAGAAGACGTTGCCTTCAAAGACCTGGATGTGGCCATTCTTGTGGGCTCCATGCCAAGAAGGG
AA
GGCATGGAGAGAAAAGATTTACTGAAAGCAAATGTGAAAATCTTCAAATCCCAGGGTGCAGCCTTAGA
T
AAATACGCCAAGAAGTCAGTTAAGGTTATTGTTGTGGGTAATCCAGCCAATACCAACTGCCTGACTGCT
TCC
AAGTCAGCTCCATCCATCCCCAAGGAGAACTTCAGTTGCTTGACTCGTTTGGATCACAACCGAGCTA
AA
GCTCAAATTGCTCTTAAACTTGGTGTGACTGCTAATGATGTAAAGAATGTCATTATCTGGGGAAACCA
T
TCCTCGACTCAGTATCCAGATGTCAACCATGCCAAGGTGAAATTGCAAGGAAAGGAAGTTGGTGTTTAT
GAA
GCTCTGAAAGATGACAGCTGGCTCAAGGGAGAATTTGTCACGACTGTGCAGCAGCGTGGCGCTGCTG
TC
ATCAAGGCTCGAAAACTATCCAGTGCCATGTCTGCTGCAAAAGCCATCTGTGACCACGTCAGGGACAT
C
TGGTTTGGAACCCCAGAGGGAGAGTTTGTGTCCATGGGTGTTATCTCTGATGGCAACTCCTATGGTGTT
CCT
GATGATCTGCTCTACTCATTCCCTGTTGTAATCAAGAATAAGACCTGGAAGTTTGTTGAAGGTCTCC
CT
ATTAATGATTTCTCACGTGAGAAGATGGATCTTACTGCAAAGGAACTGACAGAAGAAAAAGAAAGTGC
T
TTTGAATTTCTTTCCTCTGCCTGA


Translation (334 aa):
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIA
T
DKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVK
VIVVGNPANTNCLTA
S
KSAPSIPKENFSCLTRLDHNRAKAQ
IALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVY
E
ALKDDSWLKGEFVT
TVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGV
P
DDLLYSFPVVIK
NKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser