NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1846.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1846.1 Public Homo sapiens 2 ASB3 15 105 74 CCDS HistoryNCBI Gene:51130Re-query CCDS DB by CCDS ID:1846.1Re-query CCDS DB by GeneID:51130

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 1846.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000263634 ENSP00000263634 Accepted alive Link to Ensembl Transcript Viewer:ENST00000263634Link to Ensembl Protein Viewer:ENSP00000263634Re-query CCDS DB by Nucleotide ID:ENST00000263634Re-query CCDS DB by Protein ID:ENSP00000263634
Original member Current member EBI,WTSI OTTHUMT00000251402 OTTHUMP00000159607 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000251402Link to Vega Protein Viewer:OTTHUMP00000159607Re-query CCDS DB by Nucleotide ID:OTTHUMT00000251402Re-query CCDS DB by Protein ID:OTTHUMP00000159607
Original member Current member NCBI NM_016115.4 NP_057199.1 Accepted alive Link to Nucleotide Sequence:NM_016115.4Link to Protein Sequence:NP_057199.1Re-query CCDS DB by Nucleotide ID:NM_016115Re-query CCDS DB by Protein ID:NP_057199Link to BLink:NP_057199.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057199.1 518 Q9Y575-1 518 100% 0 0

Chromosomal Locations for CCDS 1846.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 2 (NC_000002.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 53897640 53897827 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53921021 53921151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53927408 53927665 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53941521 53941718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53943703 53943880 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53955849 53955984 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53956595 53956707 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53977920 53978078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53992514 53992709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1557 nt):
ATGGATTTTACAGAGGCTTACGCGGACACGTGCTCTACAGTTGGACTTGCTGCCAGGGAAGGCAATGTTA
AA
GTCTTAAGGAAACTGCTCAAAAAGGGCCGAAGTGTCGATGTTGCTGATAACAGGGGATGGATGCCAAT
T
CATGAAGCAGCTTATCACAACTCTGTAGAATGTTTGCAAATGTTAATTAATGCAGATTCATCTGAAAAC
TAC
ATTAAGATGAAGACCTTTGAAGGTTTCTGTGCTTTGCATCTCGCTGCAAGTCAAGGACATTGGAAAA
TC
GTACAGATTCTTTTAGAAGCTGGGGCAGATCCTAATGCAACTACTTTAGAAGAAACGACACCATTGTT
T
TTAGCTGTTGAAAATGGACAGATAGATGTGTTAAGGCTGTTGCTTCAACACGGAGCAAATGTTAATGGA
TCC
CATTCTATGTGTGGATGGAACTCCTTGCACCAGGCTTCTTTTCAGGAAAATGCTGAGATCATAAAAT
TG
CTTCTTAGAAAAGGAGCAAACAAGGAATGCCAGGATGACTTTGGAATCACACCTTTATTTGTGGCTGC
T
CAGTATGGCAAGCTAGAAAGCTTGAGCATACTTATTTCATCGGGTGCAAATGTCAATTGTCAAGCCTTG
GAC
AAAGCTACACCCTTGTTCATTGCTGCTCAAGAGGGACACACAAAATGTGTGGAGCTTTTGCTCTCCA
GT
GGGGCAGATCCTGATCTTTACTGTAATGAGGACAGTTGGCAGTTACCTATTCATGCAGCTGCACAAAT
G
GGCCATACAAAAATCTTGGACTTGTTAATACCACTTACTAACCGGGCCTGTGACACTGGGCTAAACAAA
GTA
AGCCCTGTTTACTCAGCAGTGTTTGGGGGACATGAAGATTGCCTAGAAATATTACTCCGGAATGGCT
AC
AGCCCAGACGCCCAGGCGTGCCTTGTTTTTGGATTCAGTTCTCCTGTGTGCATGGCTTTCCAAAAGGA
C
TGTGAGTTCTTTGGAATTGTGAACATTCTTTTGAAATATGGAGCCCAGATAAATGAACTTCATTTGGCA
TAC
TGCCTGAAGTACGAGAAGTTTTCGATATTTCGCTACTTTTTGAGGAAAGGTTGCTCATTGGGACCAT
GG
AACCATATATATGAATTTGTAAATCATGCAATTAAAGCACAAGCAAAATATAAGGAGTGGTTGCCACA
T
CTTCTGGTTGCTGGATTTGACCCACTGATTCTACTGTGCAATTCTTGGATTGACTCAGTCAGCATTGAC
ACC
CTTATCTTCACTTTGGAGTTTACTAATTGGAAGACACTTGCACCAGCTGTTGAAAGGATGCTCTCTG
CT
CGTGCCTCAAACGCTTGGATTCTACAGCAACATATTGCCACTGTTCCATCCCTGACCCATCTTTGTCG
T
TTGGAAATTCGGTCCAGTCTAAAATCAGAACGTCTACGGTCTGACAGTTATATTAGTCAGCTGCCACTT
CCC
AGAAGCCTACATAATTATTTGCTCTATGAAGACGTTCTGAGGATGTATGAAGTTCCAGAACTGGCAG
CT
ATTCAAGATGGATAA


Translation (518 aa):
MDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQMLINADSSEN
Y
IKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFL
AVENGQIDVLRLLLQHGANVNG
S
HSMCGWNSLHQASFQ
ENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQAL
D
KATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHT
KILDLLIPLTNRACDTGLNK
V
SPVYSAVFGGHEDCLEILLRNGYSPDAQACLVFGFSSPVCMAFQK
DCEFFGIVNILLKYGAQINELHLA
Y
CLKYEKFSIFRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNS
WIDSVSID
T
LIFTLEFTNWKTLAPAVERMLSARASNAWILQQHI
ATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPL
P
RSLHNYLLYEDVLRMYEVPELAAIQDG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser