NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1846.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1846.1 Public Homo sapiens 2 ASB3 18 107 79 CCDS HistoryNCBI Gene:51130Re-query CCDS DB by CCDS ID:1846.1Re-query CCDS DB by GeneID:51130See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 1846.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000263634 ENSP00000263634 Accepted alive Link to Ensembl Transcript Viewer:ENST00000263634Link to Ensembl Protein Viewer:ENSP00000263634Re-query CCDS DB by Nucleotide ID:ENST00000263634Re-query CCDS DB by Protein ID:ENSP00000263634
Original member Current member EBI,WTSI OTTHUMT00000251402 OTTHUMP00000159607 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000251402Link to Vega Protein Viewer:OTTHUMP00000159607Re-query CCDS DB by Nucleotide ID:OTTHUMT00000251402Re-query CCDS DB by Protein ID:OTTHUMP00000159607
Original member Current member NCBI NM_016115.4 NP_057199.1 Accepted alive Link to Nucleotide Sequence:NM_016115.4Link to Protein Sequence:NP_057199.1Re-query CCDS DB by Nucleotide ID:NM_016115Re-query CCDS DB by Protein ID:NP_057199Link to BLink:NP_057199.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057199.1 518 Q9Y575-1 518 100% 0 0

Chromosomal Locations for CCDS 1846.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 53670503 53670690 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53693884 53694014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53700271 53700528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53714384 53714581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53716566 53716743 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53728712 53728847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53729458 53729570 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53750783 53750941 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 53765377 53765572 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1557 nt):
ATGGATTTTACAGAGGCTTACGCGGACACGTGCTCTACAGTTGGACTTGCTGCCAGGGAAGGCAATGTTA
AA
GTCTTAAGGAAACTGCTCAAAAAGGGCCGAAGTGTCGATGTTGCTGATAACAGGGGATGGATGCCAAT
T
CATGAAGCAGCTTATCACAACTCTGTAGAATGTTTGCAAATGTTAATTAATGCAGATTCATCTGAAAAC
TAC
ATTAAGATGAAGACCTTTGAAGGTTTCTGTGCTTTGCATCTCGCTGCAAGTCAAGGACATTGGAAAA
TC
GTACAGATTCTTTTAGAAGCTGGGGCAGATCCTAATGCAACTACTTTAGAAGAAACGACACCATTGTT
T
TTAGCTGTTGAAAATGGACAGATAGATGTGTTAAGGCTGTTGCTTCAACACGGAGCAAATGTTAATGGA
TCC
CATTCTATGTGTGGATGGAACTCCTTGCACCAGGCTTCTTTTCAGGAAAATGCTGAGATCATAAAAT
TG
CTTCTTAGAAAAGGAGCAAACAAGGAATGCCAGGATGACTTTGGAATCACACCTTTATTTGTGGCTGC
T
CAGTATGGCAAGCTAGAAAGCTTGAGCATACTTATTTCATCGGGTGCAAATGTCAATTGTCAAGCCTTG
GAC
AAAGCTACACCCTTGTTCATTGCTGCTCAAGAGGGACACACAAAATGTGTGGAGCTTTTGCTCTCCA
GT
GGGGCAGATCCTGATCTTTACTGTAATGAGGACAGTTGGCAGTTACCTATTCATGCAGCTGCACAAAT
G
GGCCATACAAAAATCTTGGACTTGTTAATACCACTTACTAACCGGGCCTGTGACACTGGGCTAAACAAA
GTA
AGCCCTGTTTACTCAGCAGTGTTTGGGGGACATGAAGATTGCCTAGAAATATTACTCCGGAATGGCT
AC
AGCCCAGACGCCCAGGCGTGCCTTGTTTTTGGATTCAGTTCTCCTGTGTGCATGGCTTTCCAAAAGGA
C
TGTGAGTTCTTTGGAATTGTGAACATTCTTTTGAAATATGGAGCCCAGATAAATGAACTTCATTTGGCA
TAC
TGCCTGAAGTACGAGAAGTTTTCGATATTTCGCTACTTTTTGAGGAAAGGTTGCTCATTGGGACCAT
GG
AACCATATATATGAATTTGTAAATCATGCAATTAAAGCACAAGCAAAATATAAGGAGTGGTTGCCACA
T
CTTCTGGTTGCTGGATTTGACCCACTGATTCTACTGTGCAATTCTTGGATTGACTCAGTCAGCATTGAC
ACC
CTTATCTTCACTTTGGAGTTTACTAATTGGAAGACACTTGCACCAGCTGTTGAAAGGATGCTCTCTG
CT
CGTGCCTCAAACGCTTGGATTCTACAGCAACATATTGCCACTGTTCCATCCCTGACCCATCTTTGTCG
T
TTGGAAATTCGGTCCAGTCTAAAATCAGAACGTCTACGGTCTGACAGTTATATTAGTCAGCTGCCACTT
CCC
AGAAGCCTACATAATTATTTGCTCTATGAAGACGTTCTGAGGATGTATGAAGTTCCAGAACTGGCAG
CT
ATTCAAGATGGATAA


Translation (518 aa):
MDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQMLINADSSEN
Y
IKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFL
AVENGQIDVLRLLLQHGANVNG
S
HSMCGWNSLHQASFQ
ENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQAL
D
KATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHT
KILDLLIPLTNRACDTGLNK
V
SPVYSAVFGGHEDCLEILLRNGYSPDAQACLVFGFSSPVCMAFQK
DCEFFGIVNILLKYGAQINELHLA
Y
CLKYEKFSIFRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNS
WIDSVSID
T
LIFTLEFTNWKTLAPAVERMLSARASNAWILQQHI
ATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPL
P
RSLHNYLLYEDVLRMYEVPELAAIQDG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser