NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14242.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14242.1 Public Homo sapiens X CYBB 15 105 74 CCDS HistoryNCBI Gene:1536Re-query CCDS DB by CCDS ID:14242.1Re-query CCDS DB by GeneID:1536

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 14242.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000378588 ENSP00000367851 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378588Link to Ensembl Protein Viewer:ENSP00000367851Re-query CCDS DB by Nucleotide ID:ENST00000378588Re-query CCDS DB by Protein ID:ENSP00000367851
Original member Current member EBI,WTSI OTTHUMT00000080881 OTTHUMP00000031915 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000080881Link to Vega Protein Viewer:OTTHUMP00000031915Re-query CCDS DB by Nucleotide ID:OTTHUMT00000080881Re-query CCDS DB by Protein ID:OTTHUMP00000031915
Original member Current member NCBI NM_000397.3 NP_000388.2 Accepted alive Link to Nucleotide Sequence:NM_000397.3Link to Protein Sequence:NP_000388.2Re-query CCDS DB by Nucleotide ID:NM_000397Re-query CCDS DB by Protein ID:NP_000388Link to BLink:NP_000388.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000388.2 570 P04839 570 100% 0 0

Chromosomal Locations for CCDS 14242.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome X (NC_000023.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 37639331 37639375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37641341 37641436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37642743 37642853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37651228 37651312 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37652918 37653063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37655204 37655394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37658208 37658337 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37660509 37660601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37663130 37663383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37664259 37664421 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37665640 37665786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37668820 37668944 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37670044 37670170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1713 nt):
ATGGGGAACTGGGCTGTGAATGAGGGGCTCTCCATTTTTGTCATTCTGGTTTGGCTGGGGTTGAACGTCT
TC
CTCTTTGTCTGGTATTACCGGGTTTATGATATTCCACCTAAGTTCTTTTACACAAGAAAACTTCTTGG
G
TCAGCACTGGCACTGGCCAGGGCCCCTGCAGCCTGCCTGAATTTCAACTGCATGCTGATTCTCTTGCCA
GTC
TGTCGAAATCTGCTGTCCTTCCTCAGGGGTTCCAGTGCGTGCTGCTCAACAAGAGTTCGAAGACAAC
TG
GACAGGAATCTCACCTTTCATAAAATGGTGGCATGGATGATTGCACTTCACTCTGCGATTCACACCAT
T
GCACATCTATTTAATGTGGAATGGTGTGTGAATGCCCGAGTCAATAATTCTGATCCTTATTCAGTAGCA
CTC
TCTGAACTTGGAGACAGGCAAAATGAAAGTTATCTCAATTTTGCTCGAAAGAGAATAAAGAACCCTG
AA
GGAGGCCTGTACCTGGCTGTGACCCTGTTGGCAGGCATCACTGGAGTTGTCATCACGCTGTGCCTCAT
A
TTAATTATCACTTCCTCCACCAAAACCATCCGGAGGTCTTACTTTGAAGTCTTTTGGTACACACATCAT
CTC
TTTGTGATCTTCTTCATTGGCCTTGCCATCCATGGAGCTGAACGAATTGTACGTGGGCAGACCGCAG
AG
AGTTTGGCTGTGCATAATATAACAGTTTGTGAACAAAAAATCTCAGAATGGGGAAAAATAAAGGAATG
C
CCAATCCCTCAGTTTGCTGGAAACCCTCCTATGACTTGGAAATGGATAGTGGGTCCCATGTTTCTGTAT
CTC
TGTGAGAGGTTGGTGCGGTTTTGGCGATCTCAACAGAAGGTGGTCATCACCAAGGTGGTCACTCACC
CT
TTCAAAACCATCGAGCTACAGATGAAGAAGAAGGGGTTCAAAATGGAAGTGGGACAATACATTTTTGT
C
AAGTGCCCAAAGGTGTCCAAGCTGGAGTGGCACCCTTTTACACTGACATCCGCCCCTGAGGAAGACTTC
TTT
AGTATCCATATCCGCATCGTTGGGGACTGGACAGAGGGGCTGTTCAATGCTTGTGGCTGTGATAAGC
AG
GAGTTTCAAGATGCGTGGAAACTACCTAAGATAGCGGTTGATGGGCCCTTTGGCACTGCCAGTGAAGA
T
GTGTTCAGCTATGAGGTGGTGATGTTAGTGGGAGCAGGGATTGGGGTCACACCCTTCGCATCCATTCTC
AAG
TCAGTCTGGTACAAATATTGCAATAACGCCACCAATCTGAAGCTCAAAAAGATCTACTTCTACTGGC
TG
TGCCGGGACACACATGCCTTTGAGTGGTTTGCAGATCTGCTGCAACTGCTGGAGAGCCAGATGCAGGA
A
AGGAACAATGCCGGCTTCCTCAGCTACAACATCTACCTCACTGGCTGGGATGAGTCTCAGGCCAATCAC
TTT
GCTGTGCACCATGATGAGGAGAAAGATGTGATCACAGGCCTGAAACAAAAGACTTTGTATGGACGGC
CC
AACTGGGATAATGAATTCAAGACAATTGCAAGTCAACACCCTAATACCAGAATAGGAGTTTTCCTCTG
T
GGACCTGAAGCCTTGGCTGAAACCCTGAGTAAACAAAGCATCTCCAACTCTGAGTCTGGCCCTCGGGGA
GTG
CATTTCATTTTCAACAAGGAAAACTTCTAA


Translation (570 aa):
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLP
V
CRNLLSFLRGSSA
CCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVA
L
SELGDRQNESYLNFARKRIK
NPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHH
L
FVIFFIGLAIHGA
ERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLY
L
CERLVRFWRSQQKVVITK
VVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDF
F
SIHIRIVGDWTEGLFNACGCDKQEFQDAWKLP
KIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
K
SVWYKYCNNATNLKLKK
IYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANH
F
AVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHP
NTRIGVFLCGPEALAETLSKQSISNSESGPRG
V
HFIFNKENF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser