NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14242.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14242.1 Public Homo sapiens X CYBB 17 106 76 CCDS HistoryNCBI Gene:1536Re-query CCDS DB by CCDS ID:14242.1Re-query CCDS DB by GeneID:1536

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 14242.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000378588 ENSP00000367851 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378588Link to Ensembl Protein Viewer:ENSP00000367851Re-query CCDS DB by Nucleotide ID:ENST00000378588Re-query CCDS DB by Protein ID:ENSP00000367851
Original member Current member EBI,WTSI OTTHUMT00000080881 OTTHUMP00000031915 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000080881Link to Vega Protein Viewer:OTTHUMP00000031915Re-query CCDS DB by Nucleotide ID:OTTHUMT00000080881Re-query CCDS DB by Protein ID:OTTHUMP00000031915
Original member Current member NCBI NM_000397.3 NP_000388.2 Accepted alive Link to Nucleotide Sequence:NM_000397.3Link to Protein Sequence:NP_000388.2Re-query CCDS DB by Nucleotide ID:NM_000397Re-query CCDS DB by Protein ID:NP_000388Link to BLink:NP_000388.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000388.2 570 P04839 570 100% 0 0

Chromosomal Locations for CCDS 14242.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 37780078 37780122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37782088 37782183 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37783490 37783600 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37791975 37792059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37793665 37793810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37795951 37796141 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37798955 37799084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37801256 37801348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37803877 37804130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37805006 37805168 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37806387 37806533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37809567 37809691 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 37810791 37810917 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1713 nt):
ATGGGGAACTGGGCTGTGAATGAGGGGCTCTCCATTTTTGTCATTCTGGTTTGGCTGGGGTTGAACGTCT
TC
CTCTTTGTCTGGTATTACCGGGTTTATGATATTCCACCTAAGTTCTTTTACACAAGAAAACTTCTTGG
G
TCAGCACTGGCACTGGCCAGGGCCCCTGCAGCCTGCCTGAATTTCAACTGCATGCTGATTCTCTTGCCA
GTC
TGTCGAAATCTGCTGTCCTTCCTCAGGGGTTCCAGTGCGTGCTGCTCAACAAGAGTTCGAAGACAAC
TG
GACAGGAATCTCACCTTTCATAAAATGGTGGCATGGATGATTGCACTTCACTCTGCGATTCACACCAT
T
GCACATCTATTTAATGTGGAATGGTGTGTGAATGCCCGAGTCAATAATTCTGATCCTTATTCAGTAGCA
CTC
TCTGAACTTGGAGACAGGCAAAATGAAAGTTATCTCAATTTTGCTCGAAAGAGAATAAAGAACCCTG
AA
GGAGGCCTGTACCTGGCTGTGACCCTGTTGGCAGGCATCACTGGAGTTGTCATCACGCTGTGCCTCAT
A
TTAATTATCACTTCCTCCACCAAAACCATCCGGAGGTCTTACTTTGAAGTCTTTTGGTACACACATCAT
CTC
TTTGTGATCTTCTTCATTGGCCTTGCCATCCATGGAGCTGAACGAATTGTACGTGGGCAGACCGCAG
AG
AGTTTGGCTGTGCATAATATAACAGTTTGTGAACAAAAAATCTCAGAATGGGGAAAAATAAAGGAATG
C
CCAATCCCTCAGTTTGCTGGAAACCCTCCTATGACTTGGAAATGGATAGTGGGTCCCATGTTTCTGTAT
CTC
TGTGAGAGGTTGGTGCGGTTTTGGCGATCTCAACAGAAGGTGGTCATCACCAAGGTGGTCACTCACC
CT
TTCAAAACCATCGAGCTACAGATGAAGAAGAAGGGGTTCAAAATGGAAGTGGGACAATACATTTTTGT
C
AAGTGCCCAAAGGTGTCCAAGCTGGAGTGGCACCCTTTTACACTGACATCCGCCCCTGAGGAAGACTTC
TTT
AGTATCCATATCCGCATCGTTGGGGACTGGACAGAGGGGCTGTTCAATGCTTGTGGCTGTGATAAGC
AG
GAGTTTCAAGATGCGTGGAAACTACCTAAGATAGCGGTTGATGGGCCCTTTGGCACTGCCAGTGAAGA
T
GTGTTCAGCTATGAGGTGGTGATGTTAGTGGGAGCAGGGATTGGGGTCACACCCTTCGCATCCATTCTC
AAG
TCAGTCTGGTACAAATATTGCAATAACGCCACCAATCTGAAGCTCAAAAAGATCTACTTCTACTGGC
TG
TGCCGGGACACACATGCCTTTGAGTGGTTTGCAGATCTGCTGCAACTGCTGGAGAGCCAGATGCAGGA
A
AGGAACAATGCCGGCTTCCTCAGCTACAACATCTACCTCACTGGCTGGGATGAGTCTCAGGCCAATCAC
TTT
GCTGTGCACCATGATGAGGAGAAAGATGTGATCACAGGCCTGAAACAAAAGACTTTGTATGGACGGC
CC
AACTGGGATAATGAATTCAAGACAATTGCAAGTCAACACCCTAATACCAGAATAGGAGTTTTCCTCTG
T
GGACCTGAAGCCTTGGCTGAAACCCTGAGTAAACAAAGCATCTCCAACTCTGAGTCTGGCCCTCGGGGA
GTG
CATTTCATTTTCAACAAGGAAAACTTCTAA


Translation (570 aa):
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPAACLNFNCMLILLP
V
CRNLLSFLRGSSA
CCSTRVRRQLDRNLTFHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVA
L
SELGDRQNESYLNFARKRIK
NPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHH
L
FVIFFIGLAIHGA
ERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIPQFAGNPPMTWKWIVGPMFLY
L
CERLVRFWRSQQKVVITK
VVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDF
F
SIHIRIVGDWTEGLFNACGCDKQEFQDAWKLP
KIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
K
SVWYKYCNNATNLKLKK
IYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANH
F
AVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHP
NTRIGVFLCGPEALAETLSKQSISNSESGPRG
V
HFIFNKENF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser