NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13158.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13158.1 Public Homo sapiens 20 CST3 17 106 76 CCDS HistoryNCBI Gene:1471Re-query CCDS DB by CCDS ID:13158.1Re-query CCDS DB by GeneID:1471

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 13158.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000376925 ENSP00000366124 Accepted alive Link to Ensembl Transcript Viewer:ENST00000376925Link to Ensembl Protein Viewer:ENSP00000366124Re-query CCDS DB by Nucleotide ID:ENST00000376925Re-query CCDS DB by Protein ID:ENSP00000366124
Original member Current member EBI,WTSI ENST00000398409 ENSP00000381446 Accepted alive Link to Ensembl Transcript Viewer:ENST00000398409Link to Ensembl Protein Viewer:ENSP00000381446Re-query CCDS DB by Nucleotide ID:ENST00000398409Re-query CCDS DB by Protein ID:ENSP00000381446
Original member Current member EBI,WTSI ENST00000398411 ENSP00000381448 Accepted alive Link to Ensembl Transcript Viewer:ENST00000398411Link to Ensembl Protein Viewer:ENSP00000381448Re-query CCDS DB by Nucleotide ID:ENST00000398411Re-query CCDS DB by Protein ID:ENSP00000381448
Original member Current member EBI,WTSI OTTHUMT00000078346 OTTHUMP00000030440 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000078346Link to Vega Protein Viewer:OTTHUMP00000030440Re-query CCDS DB by Nucleotide ID:OTTHUMT00000078346Re-query CCDS DB by Protein ID:OTTHUMP00000030440
Original member Current member EBI,WTSI OTTHUMT00000256831 OTTHUMP00000164181 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000256831Link to Vega Protein Viewer:OTTHUMP00000164181Re-query CCDS DB by Nucleotide ID:OTTHUMT00000256831Re-query CCDS DB by Protein ID:OTTHUMP00000164181
Original member Current member EBI,WTSI OTTHUMT00000256832 OTTHUMP00000164182 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000256832Link to Vega Protein Viewer:OTTHUMP00000164182Re-query CCDS DB by Nucleotide ID:OTTHUMT00000256832Re-query CCDS DB by Protein ID:OTTHUMP00000164182
Original member Current member NCBI NM_000099.3 NP_000090.1 Accepted alive Link to Nucleotide Sequence:NM_000099.3Link to Protein Sequence:NP_000090.1Re-query CCDS DB by Nucleotide ID:NM_000099Re-query CCDS DB by Protein ID:NP_000090Link to BLink:NP_000090.1
Original member Current member NCBI NM_001288614.1 NP_001275543.1 Accepted alive Link to Nucleotide Sequence:NM_001288614.1Link to Protein Sequence:NP_001275543.1Re-query CCDS DB by Nucleotide ID:NM_001288614Re-query CCDS DB by Protein ID:NP_001275543Link to BLink:NP_001275543.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000090.1 146 P01034 146 100% 0 0
NP_001275543.1 146 P01034 146 100% 0 0

Chromosomal Locations for CCDS 13158.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 20Link to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20

Chromosome Start Stop Links
20 23633916 23633999 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 23635254 23635367 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20
20 23637620 23637862 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20Link to Vega Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (441 nt):
ATGGCCGGGCCCCTGCGCGCCCCGCTGCTCCTGCTGGCCATCCTGGCCGTGGCCCTGGCCGTGAGCCCCG
CG
GCCGGCTCCAGTCCCGGCAAGCCGCCGCGCCTAGTGGGAGGCCCCATGGACGCCAGCGTGGAGGAGGA
G
GGTGTGCGGCGTGCACTGGACTTTGCCGTCGGCGAGTACAACAAAGCCAGCAACGACATGTACCACAGC
CGC
GCGCTGCAGGTGGTGCGCGCCCGCAAGCAGATCGTAGCTGGGGTGAACTACTTCTTGGACGTGGAGC
TG
GGCCGAACCACGTGTACCAAGACCCAGCCCAACTTGGACAACTGCCCCTTCCATGACCAGCCACATCT
G
AAAAGGAAAGCATTCTGCTCTTTCCAGATCTACGCTGTGCCTTGGCAGGGCACAATGACCTTGTCGAAA
TCC
ACCTGTCAGGACGCCTAG


Translation (146 aa):
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS
R
ALQVVRARKQ
IVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSK
S
TCQDA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser