NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12552.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12552.1 Public Homo sapiens 19 AKT2 17 106 76 CCDS HistoryNCBI Gene:208Re-query CCDS DB by CCDS ID:12552.1Re-query CCDS DB by GeneID:208See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 12552.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000392038 ENSP00000375892 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392038Link to Ensembl Protein Viewer:ENSP00000375892Re-query CCDS DB by Nucleotide ID:ENST00000392038Re-query CCDS DB by Protein ID:ENSP00000375892
Original member Current member EBI,WTSI OTTHUMT00000268029 OTTHUMP00000174417 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000268029Link to Vega Protein Viewer:OTTHUMP00000174417Re-query CCDS DB by Nucleotide ID:OTTHUMT00000268029Re-query CCDS DB by Protein ID:OTTHUMP00000174417
Original member Current member NCBI NM_001626.5 NP_001617.1 Accepted alive Link to Nucleotide Sequence:NM_001626.5Link to Protein Sequence:NP_001617.1Re-query CCDS DB by Nucleotide ID:NM_001626Re-query CCDS DB by Protein ID:NP_001617Link to BLink:NP_001617.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001617.1 481 P31751-1 481 100% 0 0

Chromosomal Locations for CCDS 12552.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 40233872 40233951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40235045 40235147 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40235263 40235350 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40235890 40236104 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40236257 40236385 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40237969 40238091 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40238905 40238973 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40240045 40240110 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40241938 40242069 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40242534 40242687 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40255158 40255269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40256926 40257054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 40265222 40265267 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1446 nt):
ATGAATGAGGTGTCTGTCATCAAAGAAGGCTGGCTCCACAAGCGTGGTGAATACATCAAGACCTGGAGGC
CA
CGGTACTTCCTGCTGAAGAGCGACGGCTCCTTCATTGGGTACAAGGAGAGGCCCGAGGCCCCTGATCA
G
ACTCTACCCCCCTTAAACAACTTCTCCGTAGCAGAATGCCAGCTGATGAAGACCGAGAGGCCGCGACCC
AAC
ACCTTTGTCATACGCTGCCTGCAGTGGACCACAGTCATCGAGAGGACCTTCCACGTGGATTCTCCAG
AC
GAGAGGGAGGAGTGGATGCGGGCCATCCAGATGGTCGCCAACAGCCTCAAGCAGCGGGCCCCAGGCGA
G
GACCCCATGGACTACAAGTGTGGCTCCCCCAGTGACTCCTCCACGACTGAGGAGATGGAAGTGGCGGTC
AGC
AAGGCACGGGCTAAAGTGACCATGAATGACTTCGACTATCTCAAACTCCTTGGCAAGGGAACCTTTG
GC
AAAGTCATCCTGGTGCGGGAGAAGGCCACTGGCCGCTACTACGCCATGAAGATCCTGCGGAAGGAAGT
C
ATCATTGCCAAGGATGAAGTCGCTCACACAGTCACCGAGAGCCGGGTCCTCCAGAACACCAGGCACCCG
TTC
CTCACTGCGCTGAAGTATGCCTTCCAGACCCACGACCGCCTGTGCTTTGTGATGGAGTATGCCAACG
GG
GGTGAGCTGTTCTTCCACCTGTCCCGGGAGCGTGTCTTCACAGAGGAGCGGGCCCGGTTTTATGGTGC
A
GAGATTGTCTCGGCTCTTGAGTACTTGCACTCGCGGGACGTGGTATACCGCGACATCAAGCTGGAAAAC
CTC
ATGCTGGACAAAGATGGCCACATCAAGATCACTGACTTTGGCCTCTGCAAAGAGGGCATCAGTGACG
GG
GCCACCATGAAAACCTTCTGTGGGACCCCGGAGTACCTGGCGCCTGAGGTGCTGGAGGACAATGACTA
T
GGCCGGGCCGTGGACTGGTGGGGGCTGGGTGTGGTCATGTACGAGATGATGTGCGGCCGCCTGCCCTTC
TAC
AACCAGGACCACGAGCGCCTCTTCGAGCTCATCCTCATGGAAGAGATCCGCTTCCCGCGCACGCTCA
GC
CCCGAGGCCAAGTCCCTGCTTGCTGGGCTGCTTAAGAAGGACCCCAAGCAGAGGCTTGGTGGGGGGCC
C
AGCGATGCCAAGGAGGTCATGGAGCACAGGTTCTTCCTCAGCATCAACTGGCAGGACGTGGTCCAGAAG
AAG
CTCCTGCCACCCTTCAAACCTCAGGTCACGTCCGAGGTCGACACAAGGTACTTCGATGATGAATTTA
CC
GCCCAGTCCATCACAATCACACCCCCTGACCGCTATGACAGCCTGGGCTTACTGGAGCTGGACCAGCG
G
ACCCACTTCCCCCAGTTCTCCTACTCGGCCAGCATCCGCGAGTGA


Translation (481 aa):
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRP
N
TFVIRCLQWTTVIERTFHVDSPDE
REEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAV
S
KARAKV
TMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHP
F
LT
ALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLEN
L
MLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPE
VLEDNDYGRAVDWWGLGVVMYEMMCGRLPF
Y
NQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQ
RLGGGPSDAKEVMEHRFFLSINWQDVVQK
K
LLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser