NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11923.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11923.2 Public Homo sapiens 18 SETBP1 17 106 76 CCDS HistoryNCBI Gene:26040Re-query CCDS DB by CCDS ID:11923.2Re-query CCDS DB by GeneID:26040See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Public Note for CCDS 11923.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and conservation data.

Sequence IDs included in CCDS 11923.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000282030 ENSP00000282030 Accepted alive Link to Ensembl Transcript Viewer:ENST00000282030Link to Ensembl Protein Viewer:ENSP00000282030Re-query CCDS DB by Nucleotide ID:ENST00000282030Re-query CCDS DB by Protein ID:ENSP00000282030
Original member Current member EBI,WTSI OTTHUMT00000255854 OTTHUMP00000163447 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000255854Link to Vega Protein Viewer:OTTHUMP00000163447Re-query CCDS DB by Nucleotide ID:OTTHUMT00000255854Re-query CCDS DB by Protein ID:OTTHUMP00000163447
Original member Current member NCBI NM_015559.2 NP_056374.2 Accepted alive Link to Nucleotide Sequence:NM_015559.2Link to Protein Sequence:NP_056374.2Re-query CCDS DB by Nucleotide ID:NM_015559Re-query CCDS DB by Protein ID:NP_056374Link to BLink:NP_056374.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_056374.2 1596 Q9Y6X0-1 1596 100% 0 0

Chromosomal Locations for CCDS 11923.2

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 18 (NC_000018.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 44701347 44701832 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 44869230 44869283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 44949881 44953340 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 45038485 45038655 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 45063079 45063698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4791 nt):
ATGGAGTCCAGGGAAACCTTAAGCAGCTCCCGGCAAAGAGGGGGCGAGTCAGACTTCCTGCCGGTCTCCT
CA
GCCAAGCCCCCAGCTGCTCCTGGCTGTGCAGGAGAACCTTTGCTCTCCACTCCAGGACCTGGGAAGGG
G
ATCCCGGTGGGCGGAGAGCGCATGGAGCCAGAGGAGGAGGATGAACTAGGCTCAGGGCGGGATGTGGAT
TCC
AACTCCAACGCGGACAGTGAGAAATGGGTGGCAGGAGATGGTTTGGAAGAGCAGGAATTTTCTATCA
AG
GAGGCAAACTTCACAGAGGGAAGTCTGAAGCTAAAGATTCAGACCACAAAGCGGGCTAAGAAACCCCC
A
AAGAATTTGGAGAACTATATATGTCCACCTGAGATCAAGATCACCATCAAGCAGTCTGGGGACCAGAAG
GTG
TCCCGTGCTGGAAAAAATAGCAAAGCCACGAAGGAGGAAGAAAGAAGCCACTCCAAAAAGAAGCTCC
TC
ACAGCCAGTGACCTTGCAGCCAGTGACCTCAAAGGATTTCAGCCACAGGCTTACGAGAGGCCCCAGAA
A
CATTCAACTCTCCATTATGACACGGGCCTCCCACAGGACTTCACCGGTGACACCTTAAAACCAAAGCAC
CAG
CAAAAAAGCAGCAGCCAGAACCACATGGACTGGTCCACCAACTCTGACAGCGGACCCGTCACTCAGA
AT
TGCTTCATCAGTCCAGAGTCTGGCAGAGAAACTGCAAGCACCAGCAAGATCCCCGCTCTTGAGCCCGT
G
GCTTCCTTTGCAAAGGCCCAGGGTAAGAAAGGCAGTGCAGGGAACACGTGGAGTCAGTTGTCTAACAAT
AAC
AAAGATCTGCTCTTGGGAGGTGTGGCTCCATCCCCAAGCAGCCACAGCTCACCAGCCCCACCCAGCA
GC
TCTGCTGAGTGCAACGGGCTTCAGCCCTTGGTGGATCAAGATGGAGGAGGTACAAAGGAGCCCCCAGA
A
CCACCTACGGTGGGCAGCAAGAAAAAGTCCAGTAAAAAAGATGTGATAAGTCAGACCATACCAAACCCA
GAC
CTGGATTGGGTCAAGAATGCCCAGAAAGCATTTGACAATACAGAAGGGAAAAGGGAAGGTTATTCCG
CA
GATAGTGCCCAAGAGGCATCACCAGCCAGGCAGAACGTGAGTTCTGCCAGTAATCCTGAAAATGACTC
A
AGTCATGTCCGGATTACTATCCCCATCAAGGCACCCTCTCTGGATCCAACCAACCATAAGAGGAAAAAA
AGA
CAGTCCATTAAAGCGGTGGTGGAAAAGATCATGCCAGAGAAAGCCTTGGCTTCTGGAATCACCATGA
GC
AGTGAAGTAGTTAACAGGATACTTTCCAACTCTGAGGGGAATAAGAAGGATCCCCGTGTCCCTAAGTT
G
AGTAAAATGATAGAGAATGAGTCCCCCTCAGTTGGCCTTGAAACTGGTGGAAATGCTGAGAAAGTTATC
CCA
GGAGGTGTGTCTAAGCCGCGGAAGCCACCCATGGTCATGACACCTCCAACGTGCACAGATCACTCTC
CA
TCCAGAAAGCTGCCAGAAATCCAGCATCCAAAATTTGCTGCAAAACGAAGGTGGACTTGCAGCAAACC
A
AAACCTAGCACCATGCTTCGAGAGGCAGTTATGGCCACCTCTGATAAACTGATGCTGGAGCCCCCGTCT
GCA
TATCCCATCACCCCATCCAGCCCTCTCTACACCAACACAGACAGTCTTACTGTGATCACTCCAGTCA
AA
AAGAAGCGGGGACGACCAAAGAAGCAGCCTTTGCTCACAGTCGAGACGATTCATGAGGGAACTTCCAC
C
AGCCCCGTCAGTCCCATCAGCCGAGAGTTTCCTGGCACTAAGAAAAGAAAGCGACGACGCAATTTAGCG
AAG
TTGGCCCAGCTAGTGCCGGGAGAGGACAAACCCATGAGCGAGATGAAATTTCACAAGAAAGTTGGAA
AG
CTCGGCGTGTTGGATAAGAAGACCATCAAAACTATCAATAAGATGAAGACACTCAAGAGGAAAAACAT
C
TTGAATCAGATCTTGTCCTGTTCCAGCAGCGTTGCTCTGAAGGCAAAAGCTCCCCCAGAGACCAGCCCT
GGG
GCAGCAGCCATTGAAAGCAAACTGGGCAAGCAGATTAATGTCAGCAAGAGGGGAACCATCTACATTG
GC
AAGAAGCGGGGCAGGAAGCCAAGAGCAGAGCTGCCACCCCCATCCGAAGAACCCAAAACAGCCATCAA
G
CACCCCAGGCCTGTTTCTAGCCAGCCGGATGTTCCAGCCGTGCCTTCCAACTTTCAGTCACTTGTGGCG
TCT
TCACCAGCAGCTATGCACCCACTTTCAACACAGTTAGGTGGGTCCAATGGCAACCTGAGCCCTGCCA
GC
ACTGAAACCAATTTTTCAGAGTTGAAAACTATGCCAAATCTCCAGCCCATCAGTGCTCTTCCAACCAA
A
ACCCAAAAGGGAATACACAGTGGAACCTGGAAGCTGTCTCCACCCAGACTGATGGCCAACTCCCCTTCA
CAC
CTGTGCGAGATTGGCTCCCTAAAGGAAATCACGCTGTCCCCTGTGAGCGAGTCCCACAGTGAGGAGA
CG
ATCCCCAGCGACAGCGGCATTGGGACAGACAACAACAGCACTTCTGACCAAGCGGAGAAGAGCTCAGA
A
TCCCGAAGGAGGTACTCTTTTGATTTCTGCTCCCTGGACAACCCGGAGGCCATTCCGTCCGACACCAGC
ACA
AAGAACCGGCATGGCCACCGGCAAAAGCATCTCATTGTGGACAACTTTCTGGCCCACGAAAGCCTCA
AG
AAGCCAAAGCACAAGAGGAAACGGAAAAGCCTGCAAAACCGCGATGACCTCCAGTTTCTGGCAGACCT
G
GAGGAGCTAATCACCAAGTTCCAAGTGTTCAGAATCTCCCACCGGAGTTACACCTTCTACCACGAGAAT
CCA
TATCCCAGCATTTTTCGGATTAATTTTGATCACTATTACCCGGTGCCATATATCCAGTATGACCCGT
TG
CTCTATCTTCGTAGGACTTCAGACTTGAAGTCAAAGAAGAAGCGTGGTAGGCCTGCAAAAACCAATGA
C
ACCATGACAAAGGTGCCTTTTTTACAAGGGTTCAGCTACCCTATTCCCAGTGGAAGTTACTATGCACCC
TAT
GGAATGCCTTACACATCAATGCCTATGATGAACCTTGGTTATTACGGTCAGTACCCAGCTCCTTTGT
AC
CTATCGCACACGCTTGGAGCAGCTTCCCCATTCATGAGGCCAACAGTGCCACCACCTCAGTTCCACAC
A
AACTCCCACGTAAAGATGTCCGGTGCAGCTAAGCATAAAGCCAAGCATGGAGTACACCTGCAGGGACCT
GTT
AGCATGGGCCTTGGTGACATGCAGCCTTCTCTGAACCCTCCCAAGGTAGGCAGTGCCAGTCTGTCCA
GT
GGTCGGCTCCATAAGAGGAAACACAAACACAAGCATAAGCACAAGGAAGACCGGATCCTAGGGACCCA
T
GACAACCTGAGTGGTCTTTTTGCAGGCAAAGCCACAGGCTTCTCCAGCCACATCCTGAGCGAGCGGCTG
AGT
AGCGCAGACAAAGAGCTCCCGCTGGTGAGTGAGAAGAACAAGCATAAGGAGAAACAGAAGCACCAGC
AC
AGCGAAGCCGGCCACAAAGCTTCTAAGAACAACTTTGAGGTGGACACCCTGTCTACACTGTCACTTTC
C
GACGCCCAGCATTGGACACAGGCCAAGGAAAAAGGAGACTTGAGCAGTGAGCCTGTGGACTCATGCACG
AAA
AGATACTCTGGCAGTGGCGGGGATGGTGGCAGCACGAGATCAGAGAACCTGGACGTGTTCAGTGAAA
TG
AACCCTTCGAATGACAAGTGGGACAGTGACGTGAGTGGGAGTAAAAGGAGGAGCTATGAAGGCTTTGG
A
ACGTACAGGGAAAAGGACATCCAAGCCTTCAAGATGAACCGCAAGGAGAGAAGTTCTTATGACTCCTCC
ATG
TCTCCAGGGATGCCAAGTCCCCACTTAAAAGTGGACCAGACAGCAGTGCATAGTAAGAACGAAGGCT
CA
GTGCCCACCATGATGACCAGGAAGAAGCCAGCCGCAGTTGACAGTGTTACAATTCCACCAGCCCCAGT
G
TTATCTCTCCTTGCTGCATCTGCAGCAACGTCGGATGCAGTCGGCTCCTCCCTGAAGAAGAGGTTCAAG
CGG
CGGGAGATCGAAGCCATCCAGTGCGAAGTGCGGAAGATGTGCAACTACACCAAGATCCTGTCCACCA
AG
AAGAACCTGGACCACGTGAACAAGATCCTGAAGGCCAAGCGGCTGCAGAGACAATCAAAAACAGGCAA
C
AACTTCGTGAAGAAGAGGCGCGGGCGTCCCAGGAAGCAGCCCACCCAGTTCGATGAGGACTCCAGAGAC
CAA
ATGCCGGTGCTGGAAAAATGCATCGACCTGCCCAGCAAAAGAGGCCAGAAGCCCAGCCTGAGCCCGC
TG
GTGCTGGAGCCCGCCGCCAGCCAAGACACCATCATGGCCACCATCGAGGCGGTCATCCACATGGCCCG
G
GAGGCGCCGCCCCTGCCCCCGCCACCGCCGCCGCCCCTGCCGCCACCGCCGCCACCACCCCTGCCCCCG
CCA
CCCCCTCTACCCAAGACCCCCCGAGGCGGAAAGAGGAAACACAAACCGCAGGCCCCCGCTCAGCCCC
CA
CAGCAGTCGCCCCCGCAGCAGCCCCTTCCCCAGGAAGAGGAGGTGAAAGCCAAAAGGCAGAGGAAGTC
C
CGAGGGAGTGAGAGCGAGGTCCTTCCCTAG


Translation (1596 aa):
MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVD
S
NSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQK
V
SRAGKNSKATKEEERSHSKKK
LLTASDLAASDLKGFQPQAYERPQKHSTLHYDTGLPQDFTGDTLKPKH
Q
QKSSSQNHMDWSTNSDSGPVTQNCFISPESGRETASTSKIPALEPVASFAKAQGKKGSAGNTWSQLSNN
N
KDLLLGGVAPSPSSHSSPAPPSSSAECNGLQPLVDQDGGGTKEPPEPPTVGSKKKSSKKDVISQTIPNP
D
LDWVKNAQKAFDNTEGKREGYSADSAQEASPARQNVSSASNPENDSSHVRITIPIKAPSLDPTNHKRKK
R
QSIKAVVEKIMPEKALASGITMSSEVVNRILSNSEGNKKDPRVPKLSKMIENESPSVGLETGGNAEKVI
P
GGVSKPRKPPMVMTPPTCTDHSPSRKLPEIQHPKFAAKRRWTCSKPKPSTMLREAVMATSDKLMLEPPS
A
YPITPSSPLYTNTDSLTVITPVKKKRGRPKKQPLLTVETIHEGTSTSPVSPISREFPGTKKRKRRRNLA
K
LAQLVPGEDKPMSEMKFHKKVGKLGVLDKKTIKTINKMKTLKRKNILNQILSCSSSVALKAKAPPETSP
G
AAAIESKLGKQINVSKRGTIYIGKKRGRKPRAELPPPSEEPKTAIKHPRPVSSQPDVPAVPSNFQSLVA
S
SPAAMHPLSTQLGGSNGNLSPASTETNFSELKTMPNLQPISALPTKTQKGIHSGTWKLSPPRLMANSPS
H
LCEIGSLKEITLSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYSFDFCSLDNPEAIPSDTS
T
KNRHGHRQKHLIVDNFLAHESLKKPKHKRKRKSLQNRDDLQFLADLEELITKFQVFRISHRSYTFYHEN
P
YPSIFRINFDHYYPVPYIQYDPLLYLRRTSDLKSKKKRGRPAKTNDTMTKVPFLQGFSYPIPSGSYYAP
Y
GMPYTSMPMMNLGYYGQYPAPLYLSHTLGAASPFMRPTVPPPQFHTNSHVKMSGAAKHKAKHGVHLQGP
V
SMGLGDMQPSLNPPKVGSASLSSGRLHKRKHKHKHKHKEDRILGTHDNLSGLFAGKATGFSSHILSERL
S
SADKELPLVSEKNKHKEKQKHQHSEAGHKASKNNFEVDTLSTLSLSDAQHWTQAKEKGDLSSEPVDSCT
K
RYSGSGGDGGSTRSENLDVFSEMNPSNDKWDSDVSGSKRRSYEGFGTYREKDIQAFKMNRKERSSYDSS
M
SP
GMPSPHLKVDQTAVHSKNEGSVPTMMTRKKPAAVDSVTIPPAPVLSLLAASAATSDAVGSSLKKRFK
R
REIEAIQCEVRKMCNYTKILSTKKNLDHVNKILKAKRLQRQSKTGNNFVKKRRGRPRKQPTQFDEDSRD
Q
MPVLEKCIDLPSKRGQKPSLSPLVLEPAASQDTIMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPLPP
P
PPLPKTPRGGKRKHKPQAPAQPPQQSPPQQPLPQEEEVKAKRQRKSRGSESEVLP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser