NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11509.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11509.1 Public Homo sapiens 17 CDC27 17 106 76 CCDS HistoryNCBI Gene:996Re-query CCDS DB by CCDS ID:11509.1Re-query CCDS DB by GeneID:996

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 11509.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000066544 ENSP00000066544 Accepted alive Link to Ensembl Transcript Viewer:ENST00000066544Link to Ensembl Protein Viewer:ENSP00000066544Re-query CCDS DB by Nucleotide ID:ENST00000066544Re-query CCDS DB by Protein ID:ENSP00000066544
Original member Current member EBI,WTSI OTTHUMT00000389742 OTTHUMP00000232872 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000389742Link to Vega Protein Viewer:OTTHUMP00000232872Re-query CCDS DB by Nucleotide ID:OTTHUMT00000389742Re-query CCDS DB by Protein ID:OTTHUMP00000232872
Original member NCBI NM_001256.3 NP_001247.3 Updated not alive Link to Nucleotide Sequence:NM_001256.3Link to Protein Sequence:NP_001247.3Re-query CCDS DB by Nucleotide ID:NM_001256Re-query CCDS DB by Protein ID:NP_001247
Current member NCBI NM_001256.4 NP_001247.3 Accepted alive Link to Nucleotide Sequence:NM_001256.4Link to Protein Sequence:NP_001247.3Re-query CCDS DB by Nucleotide ID:NM_001256Re-query CCDS DB by Protein ID:NP_001247Link to BLink:NP_001247.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001247.3 824 P30260-1 824 100% 0 0

Chromosomal Locations for CCDS 11509.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

Chromosome Start Stop Links
17 47120935 47121017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47122444 47122600 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47123886 47123960 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47129393 47129521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47132257 47132374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47137152 47137360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47138739 47138891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47141853 47142025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47142229 47142436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47143883 47143982 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47151806 47151918 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47154672 47154786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47156913 47157124 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47157230 47157384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47158206 47158303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47169917 47170042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47171917 47172064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47181562 47181637 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 47189146 47189172 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2475 nt):
ATGACGGTGCTGCAGGAACCCGTCCAGGCTGCTATATGGCAAGCACTAAACCACTATGCTTACCGAGATG
CG
GTTTTCCTCGCAGAACGCCTTTATGCAGAAGTACACTCAGAAGAAGCCTTGTTTTTACTGGCAACCTG
T
TATTACCGCTCAGGAAAGGCATATAAAGCATATAGACTCTTGAAAGGACACAGTTGTACTACACCGCAA
TGC
AAATACCTGCTTGCAAAATGTTGTGTTGATCTCAGCAAGCTTGCAGAAGGGGAACAAATCTTATCTG
GT
GGAGTGTTTAATAAGCAGAAAAGCCATGATGATATTGTTACTGAGTTTGGTGATTCAGCTTGCTTTAC
T
CTTTCATTGTTGGGACATGTATATTGCAAGACAGATCGGCTTGCCAAAGGATCAGAATGTTACCAAAAG
AGC
CTTAGTTTAAATCCTTTCCTCTGGTCTCCCTTTGAATCATTATGTGAAATAGGTGAAAAGCCAGATC
CT
GACCAAACATTTAAATTCACATCTTTACAGAACTTTAGCAACTGTCTGCCCAACTCTTGCACAACACA
A
GTACCTAATCATAGTTTATCTCACAGACAGCCTGAGACAGTTCTTACGGAAACACCCCAGGACACAATT
GAA
TTAAACAGATTGAATTTAGAATCTTCCAATTCAAAGTACTCCTTGAATACAGATTCCTCAGTGTCTT
AT
ATTGATTCAGCTGTAATTTCACCTGATACTGTCCCACTGGGAACAGGAACTTCCATATTATCTAAACA
G
GTTCAAAATAAACCAAAAACTGGTCGAAGTTTATTAGGAGGACCAGCAGCTCTTAGTCCATTAACCCCA
AG
T
TTTGGGATTTTGCCATTAGAAACCCCAAGTCCTGGAGATGGATCCTATTTACAAAACTACACTAATA
CA
CCTCCTGTAATTGATGTGCCATCCACCGGAGCCCCTTCAAAAAAGTCTGTTGCCAGAATCGGCCAAAC
T
GGAACAAAGTCTGTCTTCTCACAGAGTGGAAATAGCCGAGAGGTAACTCCAATTCTTGCACAAACACAA
AGT
TCTGGTCCACAAACAAGTACAACACCTCAGGTATTGAGCCCCACTATTACATCTCCCCCAAACGCAC
TG
CCTCGAAGAAGTTCACGACTCTTTACTAGTGACAGCTCCACAACCAAGGAGAATAGCAAAAAATTAAA
A
ATGAAGTTTCCACCTAAAATCCCAAACAGAAAAACAAAAAGTAAAACTAATAAAGGAGGAATAACTCAA
CCT
AACATAAATGATAGCCTGGAAATTACAAAATTGGACTCTTCCATCATTTCAGAAGGGAAAATATCCA
CA
ATCACACCTCAGATTCAGGCCTTTAATCTACAAAAAGCAGCAGCAGAAGGTTTGATGAGCCTTCTTCG
T
GAAATGGGGAAAGGTTATTTAGCTTTGTGTTCATACAACTGCAAAGAAGCTATAAATATTTTGAGCCAT
CTA
CCTTCTCACCACTACAATACTGGTTGGGTACTGTGCCAAATTGGAAGGGCCTATTTTGAACTTTCAG
AG
TACATGCAAGCTGAAAGAATATTCTCAGAGGTTAGAAGGATTGAGAATTATAGAGTTGAAGGCATGGA
G
ATCTACTCTACAACACTTTGGCATCTTCAAAAAGATGTTGCTCTTTCAGTTCTGTCAAAAGACTTAACA
GAC
ATGGATAAAAATTCGCCAGAGGCCTGGTGTGCTGCAGGGAACTGTTTCAGTCTGCAACGGGAACATG
AT
ATTGCAATTAAATTCTTCCAGAGAGCTATCCAAGTTGATCCAAATTACGCTTATGCCTATACTCTATT
A
GGGCATGAGTTTGTCTTAACTGAAGAATTGGACAAAGCATTAGCTTGTTTTCGAAATGCTATCAGAGTC
AAT
CCTAGACATTATAATGCATGGTATGGTTTAGGAATGATTTATTACAAGCAAGAAAAATTCAGCCTTG
CA
GAAATGCATTTCCAAAAAGCGCTTGATATCAACCCTCAAAGTTCAGTTTTACTTTGCCACATTGGAGT
A
GTTCAACATGCACTGAAAAAATCAGAGAAGGCTTTGGATACCCTAAACAAAGCCATTGTCATTGATCCC
AAG
AACCCTCTATGCAAATTTCACAGAGCCTCAGTTTTATTTGCAAATGAAAAATATAAGTCTGCTTTAC
AA
GAACTTGAAGAATTGAAACAAATTGTTCCCAAAGAATCCCTCGTTTACTTCTTAATAGGAAAGGTTTA
C
AAGAAGTTAGGTCAAACGCACCTCGCCCTGATGAATTTCTCTTGGGCTATGGATTTAGATCCTAAAGGA
GCC
AATAACCAGATTAAAGAGGCAATTGATAAGCGTTATCTTCCAGATGATGAGGAGCCAATAACCCAAG
AA
GAACAGATCATGGGAACAGATGAATCCCAGGAGAGCAGCATGACAGATGCGGATGACACACAACTTCA
T
GCAGCTGAAAGTGATGAATTTTAA


Translation (824 aa):
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQ
C
KYLLAKCCVDLS
KLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQK
S
LSLNPFLWSPFESLCEI
GEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTI
E
LNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTP

S
FGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQ
S
SGPQT
STTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ
P
NINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAA
EGLMSLLREMGKGYLALCSYNCKEAINILSH
L
PSHHYNTGWVLCQIGRAYFELSEYMQ
AERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT
D
MDKNSPE
AWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRV
N
PRHYNA
WYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDP
K
NPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKG
A
NNQIKEAIDKRYLPDDEEPITQEEQI
MGTDESQESSMTDADDTQLHAAESDEF



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser