NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11011.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11011.1 Public Homo sapiens 17 SERPINF2 15 105 74 CCDS HistoryNCBI Gene:5345Re-query CCDS DB by CCDS ID:11011.1Re-query CCDS DB by GeneID:5345

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 11011.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000324015 ENSP00000321853 Accepted alive Link to Ensembl Transcript Viewer:ENST00000324015Link to Ensembl Protein Viewer:ENSP00000321853Re-query CCDS DB by Nucleotide ID:ENST00000324015Re-query CCDS DB by Protein ID:ENSP00000321853
Original member Current member EBI,WTSI ENST00000382061 ENSP00000371493 Accepted alive Link to Ensembl Transcript Viewer:ENST00000382061Link to Ensembl Protein Viewer:ENSP00000371493Re-query CCDS DB by Nucleotide ID:ENST00000382061Re-query CCDS DB by Protein ID:ENSP00000371493
Original member Current member EBI,WTSI OTTHUMT00000207078 OTTHUMP00000115656 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000207078Link to Vega Protein Viewer:OTTHUMP00000115656Re-query CCDS DB by Nucleotide ID:OTTHUMT00000207078Re-query CCDS DB by Protein ID:OTTHUMP00000115656
Original member Current member NCBI NM_000934.3 NP_000925.2 Accepted alive Link to Nucleotide Sequence:NM_000934.3Link to Protein Sequence:NP_000925.2Re-query CCDS DB by Nucleotide ID:NM_000934Re-query CCDS DB by Protein ID:NP_000925Link to BLink:NP_000925.2
Original member Current member NCBI NM_001165920.1 NP_001159392.1 Accepted alive Link to Nucleotide Sequence:NM_001165920.1Link to Protein Sequence:NP_001159392.1Re-query CCDS DB by Nucleotide ID:NM_001165920Re-query CCDS DB by Protein ID:NP_001159392Link to BLink:NP_001159392.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000925.2 491 P08697-1 491 100% 0 0
NP_001159392.1 491 P08697-1 491 100% 0 0

Chromosomal Locations for CCDS 11011.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 17 (NC_000017.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

Chromosome Start Stop Links
17 1648290 1648352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 1648469 1648507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 1648627 1648689 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 1649002 1649203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 1650313 1650456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 1650603 1650806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 1651892 1652034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 1655880 1656084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 1657416 1657828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1476 nt):
ATGGCGCTGCTCTGGGGGCTCCTGGTGCTCAGCTGGTCCTGCCTGCAAGGCCCCTGCTCCGTGTTCTCCC
CT
GTGAGCGCCATGGAGCCCTTGGGCCGGCAGCTAACTAGCGGGCCGAACCAGGAGCAGGTGTCCCCACT
T
ACCCTCCTCAAGTTGGGCAACCAGGAGCCTGGTGGCCAGACTGCCCTGAAGAGTCCCCCAGGAGTCTGC
AGC
AGAGACCCCACCCCAGAGCAGACCCACAGGCTGGCCCGGGCCATGATGGCCTTCACTGCCGACCTGT
TC
TCCCTGGTGGCTCAAACGTCCACCTGCCCCAACCTCATCCTGTCACCCCTGAGTGTGGCCCTGGCGCT
G
TCTCACCTGGCACTAGGTGCTCAGAACCACACGTTGCAGAGGCTGCAACAGGTGCTGCACGCAGGCTCA
GGG
CCCTGCCTCCCCCATCTGCTGAGCCGCCTCTGCCAGGACCTGGGCCCCGGCGCGTTCCGACTGGCTG
CC
AGGATGTACCTGCAGAAAGGATTTCCCATCAAAGAAGATTTCCTGGAACAATCCGAACAGCTATTTGG
G
GCAAAGCCCGTGAGCCTGACGGGAAAGCAGGAAGATGACCTGGCAAACATCAACCAATGGGTGAAGGAG
GCC
ACGGAGGGGAAGATTCAGGAATTCCTCTCTGGGCTGCCGGAAGACACCGTGTTGCTTCTCCTCAACG
CC
ATCCACTTCCAGGGTTTCTGGAGGAACAAGTTTGACCCGAGCCTTACCCAGAGAGACTCCTTCCACCT
G
GACGAGCAGTTCACGGTGCCCGTGGAAATGATGCAGGCCCGCACGTACCCGCTGCGCTGGTTCTTGCTG
GAG
CAGCCTGAGATCCAGGTGGCTCATTTCCCCTTTAAGAACAACATGAGCTTTGTGGTCCTTGTACCCA
CC
CACTTTGAATGGAACGTGTCCCAGGTACTGGCCAACCTGAGTTGGGACACCCTGCACCCACCTCTGGT
G
TGGGAGAGGCCCACCAAGGTCCGGCTGCCTAAGCTGTATCTGAAACACCAAATGGACCTGGTGGCCACC
CTC
AGCCAGCTGGGCCTGCAGGAGTTGTTCCAGGCCCCAGACCTGCGTGGGATCTCCGAGCAGAGCCTGG
TG
GTGTCCGGCGTGCAGCATCAGTCCACCCTGGAGCTCAGCGAGGTCGGCGTGGAGGCGGCGGCGGCCAC
C
AGCATTGCCATGTCCCGCATGTCCCTGTCCTCCTTCAGCGTGAACCGCCCCTTCCTCTTCTTCATCTTC
GAG
GACACCACAGGCCTTCCCCTCTTCGTGGGCAGCGTGAGGAACCCCAACCCCAGTGCACCGCGGGAGC
TC
AAGGAACAGCAGGATTCCCCGGGCAACAAGGACTTCCTCCAGAGCCTGAAAGGCTTCCCCCGCGGAGA
C
AAGCTTTTCGGCCCTGACTTAAAACTTGTGCCCCCCATGGAGGAGGATTACCCCCAGTTTGGCAGCCCC
AAG
TGA


Translation (491 aa):
MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQTALKSPPGVC
S
RDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHLAL
GAQNHTLQRLQQVLHAGS
G
PCLPHLLSRLCQDLGPGAFRLAARMYLQK
GFPIKEDFLEQSEQLFGAKPVSLTGKQEDDLANINQWVKE
A
TEGKIQEFLSGLPEDTVLLLLNAIHFQ
GFWRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLL
E
QPEIQ
VAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVAT
L
SQL
GLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
E
DTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSP
K




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser