NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS58862.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58862.1 Public Homo sapiens 3 PEX5L 17 106 76 CCDS HistoryNCBI Gene:51555Re-query CCDS DB by CCDS ID:58862.1Re-query CCDS DB by GeneID:51555See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Sequence IDs included in CCDS 58862.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000392649 ENSP00000376420 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392649Link to Ensembl Protein Viewer:ENSP00000376420Re-query CCDS DB by Nucleotide ID:ENST00000392649Re-query CCDS DB by Protein ID:ENSP00000376420
Original member Current member EBI,WTSI ENST00000464614 ENSP00000417270 Accepted alive Link to Ensembl Transcript Viewer:ENST00000464614Link to Ensembl Protein Viewer:ENSP00000417270Re-query CCDS DB by Nucleotide ID:ENST00000464614Re-query CCDS DB by Protein ID:ENSP00000417270
Original member Current member EBI,WTSI OTTHUMT00000348584 OTTHUMP00000212026 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000348584Link to Vega Protein Viewer:OTTHUMP00000212026Re-query CCDS DB by Nucleotide ID:OTTHUMT00000348584Re-query CCDS DB by Protein ID:OTTHUMP00000212026
Original member Current member NCBI NM_001256755.1 NP_001243684.1 Accepted alive Link to Nucleotide Sequence:NM_001256755.1Link to Protein Sequence:NP_001243684.1Re-query CCDS DB by Nucleotide ID:NM_001256755Re-query CCDS DB by Protein ID:NP_001243684Link to BLink:NP_001243684.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001243684.1 518 Q8IYB4-7 518 100% 0 0

Chromosomal Locations for CCDS 58862.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 179801828 179802032 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179807674 179807831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179808272 179808437 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179809471 179809668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179811801 179811871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179815861 179816004 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179819860 179819976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179859062 179859157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179874327 179874423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179875354 179875477 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179887673 179887784 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 179898142 179898210 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1557 nt):
ATGGTGATGAAGGAGATACCGAGGGAGGAGTCTGCTGAAGAAAAGCCCCTCCTTACTATGACATCACAGC
TG
GTGAATGAGCAACAAGAAAGCAGACCCCTCCTGAGTCCCTCCATCGATGACTTTCTCTGTGAAACCAA
A
TCGGAAGCAATAGCAAGGCCAGTAACATCCAATACAGCTGACATTCAAACACAACTGGAAAAATGGGAC
GAT
GTTAAGTTTCATGGAGATCGAAATACCAAGGGACATCCAATGGCAGAGAGAAAATCATCCTCATCTA
GA
ACTGGATCAAAAGAGCTCTTATGGTCCTCAGAACACAGATCTCAACCAGAACTGAGTGGTGGAAAAAG
C
GCCCTCAACTCTGAGTCGGCTTCAGAATTGGAATTAGTGGCTCCGACTCAGGCTCGACTGACCAAAGAA
CAT
CGCTGGGGAAGCGCATTACTTTCTAGAAACCACTCCTTAGAAGAAGAGTTTGAAAGGGCAAAAGCAG
CA
GTGGAGTCAGATACAGAGTTTTGGGATAAGATGCAAGCAGAATGGGAAGAAATGGCTCGGAGGAACTG
G
ATATCTGAGAACCAAGAAGCCCAGAACCAAGTAACCATCTCGGCTAGTGAGAAGGGATATTACTTTCAC
ACT
GAAAACCCCTTCAAGGACTGGCCTGGAGCATTTGAAGAAGGCTTAAAAAGGCTGAAGGAAGGGGATC
TG
CCAGTCACCATCCTGTTCATGGAAGCAGCAATTCTTCAGGACCCTGGAGATGCAGAGGCATGGCAGTT
C
CTCGGGATAACCCAGGCGGAGAATGAAAATGAACAAGCAGCTATTGTCGCCCTCCAGAGGTGCTTAGAA
TTA
CAGCCCAACAACTTAAAAGCTTTGATGGCCTTGGCTGTGAGTTATACTAACACTGGCCATCAGCAGG
AT
GCCTGTGACGCTCTGAAGAATTGGATTAAGCAAAATCCAAAGTACAAATACCTTGTGAAAAGCAAGAA
G
GGATCTCCAGGCCTCACCCGGCGGATGTCTAAGTCCCCAGTTGATAGCTCTGTTCTGGAAGGGGTGAAG
GAA
TTATATCTGGAAGCTGCCCACCAAAATGGAGATATGATCGACCCAGACCTGCAGACAGGTCTAGGGG
TT
CTGTTCCACCTGAGTGGAGAATTTAATAGAGCAATAGATGCATTTAACGCTGCCTTAACTGTTCGGCC
A
GAGGACTATTCACTATGGAACCGCCTCGGGGCGACCTTGGCGAACGGAGACCGCAGCGAGGAAGCCGTG
GAG
GCCTATACGCGAGCACTGGAGATTCAGCCAGGATTCATCCGGTCCAGATACAACCTAGGAATAAGCT
GC
ATCAACCTGGGCGCCTACAGAGAAGCGGTCAGCAATTTTCTCACTGCCCTCAGTTTGCAAAGAAAGAG
C
AGGAATCAGCAGCAAGTTCCTCATCCTGCAATCTCTGGGAATATCTGGGCTGCCCTCAGAATTGCGCTC
TCT
CTGATGGACCAACCAGAACTCTTCCAGGCGGCTAATCTTGGTGACCTGGATGTCCTCTTAAGAGCTT
TC
AACTTGGATCCTTGA


Translation (518 aa):
MVMKEIPREESAEEKPLLTMTSQLVNEQQESRPLLSPSIDDFLCETKSEAIARPVTSNTADIQTQLEKWD
D
VKFHGDRNTKGHPMAERKSSSSRTGSKELL
WSSEHRSQPELSGGKSALNSESASELELVAPTQARLTKE
H
RWGSALLSRNHSLEEEFERAKAAVE
SDTEFWDKMQAEWEEMARRNWISENQEAQNQVTISASEKGYYFH
T
ENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAE
AWQFLGITQAENENEQAAIVALQRCLE
L
QPNNLKALMALAVSYTNTGHQQDACDALKNWIKQNPKYKYLVKSKKGSPGLTRRMSKSPVD
SSVLEGVK
E
LYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPE
DYSLWNRLGATLANGDRSEEAV
E
AYTRALEIQPGFIRSRYNLGISCINLGAY
REAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIAL
S
LMDQPELFQAANLGDLDVLLRAFNLDP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser