NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS58642.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58642.1 Public Homo sapiens 19 HSD11B1L 18 107 79 CCDS HistoryNCBI Gene:374875Re-query CCDS DB by CCDS ID:58642.1Re-query CCDS DB by GeneID:374875See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Sequence IDs included in CCDS 58642.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000583928 ENSP00000462586 Accepted alive Link to Ensembl Transcript Viewer:ENST00000583928Link to Ensembl Protein Viewer:ENSP00000462586Re-query CCDS DB by Nucleotide ID:ENST00000583928Re-query CCDS DB by Protein ID:ENSP00000462586
Original member Current member EBI,WTSI ENST00000581893 ENSP00000464454 Accepted alive Link to Ensembl Transcript Viewer:ENST00000581893Link to Ensembl Protein Viewer:ENSP00000464454Re-query CCDS DB by Nucleotide ID:ENST00000581893Re-query CCDS DB by Protein ID:ENSP00000464454
Original member Current member EBI,WTSI OTTHUMT00000442568 OTTHUMP00000259713 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000442568Link to Vega Protein Viewer:OTTHUMP00000259713Re-query CCDS DB by Nucleotide ID:OTTHUMT00000442568Re-query CCDS DB by Protein ID:OTTHUMP00000259713
Original member Current member EBI,WTSI OTTHUMT00000442575 OTTHUMP00000259720 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000442575Link to Vega Protein Viewer:OTTHUMP00000259720Re-query CCDS DB by Nucleotide ID:OTTHUMT00000442575Re-query CCDS DB by Protein ID:OTTHUMP00000259720
Original member Current member NCBI NM_001267869.1 NP_001254798.1 Accepted alive Link to Nucleotide Sequence:NM_001267869.1Link to Protein Sequence:NP_001254798.1Re-query CCDS DB by Nucleotide ID:NM_001267869Re-query CCDS DB by Protein ID:NP_001254798Link to BLink:NP_001254798.1
Original member Current member NCBI NM_198708.2 NP_941997.1 Accepted alive Link to Nucleotide Sequence:NM_198708.2Link to Protein Sequence:NP_941997.1Re-query CCDS DB by Nucleotide ID:NM_198708Re-query CCDS DB by Protein ID:NP_941997Link to BLink:NP_941997.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001254798.1 152 Q7Z5J1-7 152 100% 0 0
NP_941997.1 152 Q7Z5J1-7 152 100% 0 0

Chromosomal Locations for CCDS 58642.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 5686986 5686991 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5687282 5687375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5687503 5687668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 5687753 5687945 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (459 nt):
ATGCAGGTAAACTTTGTGAGCTACGTGCAACTGACGTCGCGGGCGCTGCCCAGCCTGACGGACAGCAAGG
GC
TCCCTGGTGGTGGTGTCCTCGCTGCTCGGCCGCGTGCCCACGTCGTTCTCCACTCCCTACTCGGCGGC
C
AAGTTTGCGCTGGACGGCTTCTTCGGCTCCCTGCGGCGGGAGCTGGACGTGCAGGACGTGAACGTGGCC
ATC
ACCATGTGCGTCCTGGGCCTCCGAGATCGCGCCTCCGCCGCCGAGGCAGTCAGGGGAGTCACGAGGG
TC
AAGGCGGCCCCGGGGCCCAAGGCAGCCCTGGCCGTGATCCGCGGCGGCGCCACGCGCGCGGCCGGCGT
C
TTCTACCCGTGGCGTTTCCGCCTGCTGTGCTTGCTCCGGCGCTGGCTACCGCGCCCGCGGGCCTGGTTT
ATC
CGCCAGGAGCTCAACGTCACGGCCGCGGCAGCCTGA


Translation (152 aa):
MQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVA
I
TMCVLGLRDRASAAEAV
RGVTRVKAAPGPKAALAVIRGGATRAAGVFYPWRFRLLCLLRRWLPRPRAWF
I
RQELNVTAAAA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser