NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55868.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55868.1 Public Homo sapiens 12 ANKS1B 17 106 76 CCDS HistoryNCBI Gene:56899Re-query CCDS DB by CCDS ID:55868.1Re-query CCDS DB by GeneID:56899See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Sequence IDs included in CCDS 55868.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000550693 ENSP00000447999 Accepted alive Link to Ensembl Transcript Viewer:ENST00000550693Link to Ensembl Protein Viewer:ENSP00000447999Re-query CCDS DB by Nucleotide ID:ENST00000550693Re-query CCDS DB by Protein ID:ENSP00000447999
Original member Current member EBI,WTSI OTTHUMT00000408426 OTTHUMP00000243460 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000408426Link to Vega Protein Viewer:OTTHUMP00000243460Re-query CCDS DB by Nucleotide ID:OTTHUMT00000408426Re-query CCDS DB by Protein ID:OTTHUMP00000243460
Original member Current member NCBI NM_001204069.1 NP_001190998.1 Accepted alive Link to Nucleotide Sequence:NM_001204069.1Link to Protein Sequence:NP_001190998.1Re-query CCDS DB by Nucleotide ID:NM_001204069Re-query CCDS DB by Protein ID:NP_001190998Link to BLink:NP_001190998.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001190998.1 450 Q7Z6G8-5 450 100% 0 0

Chromosomal Locations for CCDS 55868.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 98745739 98745849 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98751355 98751522 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98773042 98773179 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98781117 98781203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98782126 98782137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98798934 98799005 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98800997 98801125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98807844 98807915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98832029 98832136 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 99053157 99053309 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 99084925 99085023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 99154289 99154492 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1353 nt):
ATGATGTGGCAATGCCACCTCTCAGCCCAGGACTACCGCTATTACCCCGTGGACGGCTACTCCCTGCTTA
AA
CGCTTCCCTCTTCATCCTCTTACAGGACCCAGATGCCCTGTCCAAACAGTGGGACAATGGTTGGAAAG
C
ATTGGGCTACCTCAGTACGAGAACCACCTGATGGCTAATGGATTTGACAATGTGCAGTTTATGGGAAGC
AAT
GTTATGGAAGATCAGGATTTGTTGGAAATTGGAATCCTTAATTCTGGGCACAGACAAAGAATTCTAC
AG
GCAATCCAGCTCCTTCCAAAGATGAGACCCATTGGGCATGATGGCTACCATCCCACCTCTGTAGCTGA
G
TGGCTGGATTCCATTGAACTGGGCGACTACACCAAAGCCTTTCTAATTAATGGCTACACTTCGATGGAC
CTG
TTGAAAAAAATCTGGGAGGTTGAACTTATTAATGTTTTAAAAATCAATTTGATTGGCCACAGGAAAC
GT
ATTTTGGCATCTCTGGGAGACAGGCTGCACGACGATCCCCCACAGAAGCCCCCTCGGTCCATCACCCT
C
AGGTCGTCTGTCTGTGAAATATGGACGAATCAGAACGCAGGATTTCCTTTCTCAGCGATCCATCAGGTT
CAT
AATACAGGAGACTGGGGAGAACCTTCCATTACCTTGCGACCTCCGAATGAAGCCACAGCCTCTACCC
CG
GTACAGTACTGGCAGCATCACCCAGAAAAGCTTATCTTCCAGTCGTGTGATTACAAAGCTTTTTATTT
A
GGTTCTATGCTGATAAAAGAGCTTAGGGGGACAGAATCAACCCAAGATGCTTGTGCAAAAATGCGGGCT
AAC
TGTCAGAAGTCTACAGAGCAAATGAAGAAGGTCCCTACTATTATTCTTTCTGTCTCATATAAAGGAG
TC
AAATTTATTGATGCAACAAATAAGAACATAATTGCTGAGCATGAAATTCGTAATATCTCCTGTGCTGC
C
CAGGACCCAGAAGACCTCTCAACATTTGCCTATATCACAAAAGATTTGAAGTCTAATCACCACTACTGT
CAT
GTGTTTACTGCCTTTGATGTGAATTTAGCCTATGAAATCATCCTAACCCTGGGACAGGCATTCGAAG
TC
GCTTACCAGCTAGCACTACAAGCAAGAAAAGGGGGACACTCCTCCACACTTCCAGAAAGCTTTGAAAA
C
AAACCCTCCAAACCCATCCCCAAGCCCCGCGTTAGCATTCGCAAGTCCGTGCAGATCGACCCATCTGAG
CAA
AAGACTCTGGCCAATCTACCGTGGATTGTGGAGCCGGGCCAAGAAGCCAAGAGGGGCATTAATACCA
AG
TATGAAACCACGATTTTCTGA


Translation (450 aa):
MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGS
N
VMEDQDLLEIGILNSGHRQRILQAIQLLPK
MRPIGHDGYHPTSVAEWLDSIELGDYTKAFLINGYTSMD
L
LKKIWEVELIN
VLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLRSSVCEIWTNQNAGFPFSAIHQV
H
N
TGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRA
N
CQ
KSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYC
H
VFTAFDV
NLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSE
Q
KTLANLPWIVEPGQEAKRGINTKYETTIF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser