NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55851.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55851.1 Public Homo sapiens 12 PPFIA2 18 107 79 CCDS HistoryNCBI Gene:8499Re-query CCDS DB by CCDS ID:55851.1Re-query CCDS DB by GeneID:8499See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Sequence IDs included in CCDS 55851.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000541570 ENSP00000438337 Accepted alive Link to Ensembl Transcript Viewer:ENST00000541570Link to Ensembl Protein Viewer:ENSP00000438337Re-query CCDS DB by Nucleotide ID:ENST00000541570Re-query CCDS DB by Protein ID:ENSP00000438337
Original member Current member EBI,WTSI OTTHUMT00000408034 OTTHUMP00000243271 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000408034Link to Vega Protein Viewer:OTTHUMP00000243271Re-query CCDS DB by Nucleotide ID:OTTHUMT00000408034Re-query CCDS DB by Protein ID:OTTHUMP00000243271
Original member Current member NCBI NM_001220479.2 NP_001207408.1 Accepted alive Link to Nucleotide Sequence:NM_001220479.2Link to Protein Sequence:NP_001207408.1Re-query CCDS DB by Nucleotide ID:NM_001220479Re-query CCDS DB by Protein ID:NP_001207408Link to BLink:NP_001207408.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001207408.1 783 O75334-7 783 100% 0 0

Chromosomal Locations for CCDS 55851.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 81259632 81259660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81263231 81263390 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81266952 81267020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81267912 81268087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81277317 81277414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81281257 81281450 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81294835 81295035 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81299301 81299382 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81325777 81325870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81339180 81339334 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81341078 81341208 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81344664 81344693 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81347533 81347770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81353119 81353339 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81358082 81358217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81362693 81362784 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81367108 81367170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81368725 81368856 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 81369111 81369161 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2352 nt):
ATGAGACATTTAGAGGGTCAACTTGAAGAGAAGAATCAAGAACTTCAAAGAGCTAGGCAAAGAGAGAAAA
TG
AATGAGGAGCATAACAAGAGATTATCGGATACGGTTGATAGACTTCTGACTGAATCCAATGAACGCCT
A
CAACTACACTTAAAGGAAAGAATGGCTGCTCTAGAAGAAAAGAATGTTTTAATTCAAGAATCAGAAACT
TTC
AGAAAGAATCTTGAAGAATCTTTACATGATAAGGAAAGATTAGCAGAAGAAATTGAAAAGCTGAGAT
CT
GAACTTGACCAATTGAAAATGAGAACTGGCTCTTTAATTGAACCCACAATACCAAGAACTCATCTAGA
C
ACCTCAGCTGAGTTGCGGTACTCAGTGGGATCCCTAGTGGACAGCCAGTCTGATTACAGAACAACTAAA
GTA
ATAAGAAGACCAAGGAGAGGCCGCATGGGTGTGCGAAGAGATGAGCCAAAGGTGAAATCTCTTGGGG
AT
CACGAGTGGAATAGAACTCAACAGATTGGAGTACTAAGCAGCCACCCTTTTGAAAGTGACACTGAAAT
G
TCTGATATTGATGATGATGACAGAGAAACAATTTTTAGCTCAATGGATCTTCTCTCTCCAAGTGGTCAT
TCC
GATGCCCAGACGCTAGCCATGATGCTTCAGGAACAATTGGATGCCATCAACAAAGAAATCAGGCTAA
TT
CAGGAAGAAAAAGAATCTACAGAGTTGCGTGCTGAAGAAATTGAAAATAGAGTGGCTAGTGTGAGCCT
C
GAAGGCCTGAATTTGGCAAGGGTCCACCCAGGTACCTCCATTACTGCCTCTGTTACAGCTTCATCGCTG
GCC
AGTTCATCTCCCCCCAGTGGACACTCAACTCCAAAGCTCACCCCTCGAAGCCCTGCCAGGGAAATGG
AT
CGGATGGGAGTCATGACACTGCCAAGTGATCTGAGGAAACATCGGAGAAAGATTGCAGTTGTGGAAGA
A
GATGGTCGAGAGGACAAAGCAACAATTAAATGTGAAACTTCTCCTCCTCCTACCCCTAGAGCCCTCAGA
ATG
ACTCACACTCTCCCTTCTTCCTACCACAATGATGCTCGAAGTAGTTTATCTGTCTCTCTTGAGCCAG
AA
AGCCTCGGGCTTGGTAGTGCCAACAGCAGCCAAGACTCTCTTCACAAAGCCCCCAAGAAGAAAGGAAT
C
AAGTCTTCAATAGGACGTTTGTTTGGTAAAAAAGAAAAAGCTCGACTTGGGCAGCTCCGAGGCTTTATG
GAG
ACTGAAGCTGCAGCTCAGGAGTCCCTGGGGTTAGGCAAACTCGGAACTCAAGCTGAGAAGGATCGAA
GA
CTAAAGAAAAAGCATGAACTTCTTGAAGAAGCTCGGAGAAAGGGATTACCTTTTGCCCAGTGGGATGG
G
CCAACTGTGGTCGCATGGCTAGAGCTTTGGTTGGGAATGCCTGCGTGGTACGTGGCAGCCTGCCGAGCC
AAC
GTGAAGAGTGGTGCCATCATGTCTGCTTTATCTGACACTGAGATCCAGAGAGAAATTGGAATCAGCA
AT
CCACTGCATCGCTTAAAACTTCGATTAGCAATCCAGGAGATGGTTTCCCTAACAAGTCCTTCAGCTCC
T
CCAACATCTCGAACTTGTCCGGTTTTTCTACAGACCCTGGCTTATGGAGATATGAATCATGAGTGGATT
GGA
AATGAATGGCTTCCCAGCTTGGGGTTACCTCAGTACAGAAGTTACTTTATGGAATGCTTGGTAGATG
CA
AGAATGTTAGATCACCTAACAAAAAAAGATCTCCGTGTCCATTTAAAAATGGTGGATAGTTTCCATCG
A
ACAAGTTTACAATATGGAATTATGTGCTTAAAGAGGTTGAATTATGACAGAAAAGAACTAGAAAGAAGA
CGG
GAAGCAAGCCAACATGAAATAAAAGACGTGTTGGTGTGGAGCAATGACCGAGTTATTCGCTGGATAC
AA
GCAATTGGACTTCGAGAATATGCAAATAATATACTTGAGAGCGGTGTGCATGGCTCACTTATAGCCCT
G
GATGAAAACTTTGACTACAGCAGCTTAGCTTTATTATTACAGATTCCAACACAGAACACCCAGGCAAGG
CAG
ATTCTTGAAAGAGAATACAATAACCTCTTGGCCCTGGGAACTGAAAGGCGACTGGATGAAAGTGATG
AC
AAGAACTTCAGACGTGGATCAACCTGGAGAAGGCAGTTTCCTCCTCGTGAAGTACATGGAATCAGCAT
G
ATGCCTGGGTCCTCAGAAACATTACCAGCTGGATTTAGGTTAACCACAACCTCTGGGCAGTCAAGAAAA
ATG
ACAACAGATGATGGCGTCTTTTCAGTCTACTCTACCTAA


Translation (783 aa):
MRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESET
F
RKNLEESLHDK
ERLAEEIEKLRSELDQLKMRTGSLIEPTIPRTHLDTSAELRYSVGSLVDSQSDYRTTK
V
IRRPRRGRMGVRRDEPK
VKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDDRETIFSSMDLLSPSGH
S
DAQTLAMMLQEQLDAINKEI
RLIQEEKESTELRAEEIENRVASVSLEGLNLARVHPGTSITASVTASSL
A
SSSPPSGHSTPKLTPRSPAREMDRMGVMTL
PSDLRKHRRKIAVVEEDGREDKATIKCETSPPPTPRALR
M
THTLPSSYHNDAR
SSLSVSLEPESLGLGSANSSQDSLHKAPKKKGIKSSIGRLFGKKEKARLGQLRGFM
E
TEAAAQESLGLGKLGTQAEKDRRLKK
KHELLEEARRKGLPFAQWDGPTVVAWLELWLGMPAWYVAACRA
N
VKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRT
CPVFLQTLAYGDMNHEWI
G
NEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFH
RTSLQYGIMCLKRLNYDRKELERR
R
EASQHEIK
DVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQAR
Q
ILEREYNNLLALGTERRLDE
SDDKNFRRGSTWRRQFPPREVHGISMMPGSSETLPAGFRLTTTSGQSRK
M
TTD
DGVFSVYST



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser