NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS54148.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54148.1 Public Homo sapiens 17 MKS1 17 106 76 CCDS HistoryNCBI Gene:54903Re-query CCDS DB by CCDS ID:54148.1Re-query CCDS DB by GeneID:54903

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Sequence IDs included in CCDS 54148.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000537529 ENSP00000442096 Accepted alive Link to Ensembl Transcript Viewer:ENST00000537529Link to Ensembl Protein Viewer:ENSP00000442096Re-query CCDS DB by Nucleotide ID:ENST00000537529Re-query CCDS DB by Protein ID:ENSP00000442096
Original member Current member EBI,WTSI OTTHUMT00000258013 OTTHUMP00000165109 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000258013Link to Vega Protein Viewer:OTTHUMP00000165109Re-query CCDS DB by Nucleotide ID:OTTHUMT00000258013Re-query CCDS DB by Protein ID:OTTHUMP00000165109
Original member Current member NCBI NM_001165927.1 NP_001159399.1 Accepted alive Link to Nucleotide Sequence:NM_001165927.1Link to Protein Sequence:NP_001159399.1Re-query CCDS DB by Nucleotide ID:NM_001165927Re-query CCDS DB by Protein ID:NP_001159399Link to BLink:NP_001159399.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001159399.1 549 Q9NXB0-3 549 100% 0 0

Chromosomal Locations for CCDS 54148.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

Chromosome Start Stop Links
17 58206079 58206170 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58206283 58206380 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58206465 58206547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58207085 58207218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58207894 58208001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58208105 58208174 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58208513 58208583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58210659 58210724 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58210980 58211022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58212378 58212434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58212982 58213090 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58213765 58213869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58214259 58214387 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58214741 58214838 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58216088 58216243 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58216666 58216736 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58218620 58218729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 58219462 58219511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1650 nt):
ATGGCTGTGCCAGTTTCCTCATTTGCACAGCGCACGAGGTCCCGCTTTCGAGTCCACCTGCAAAGAATCA
CA
TCAAGCAACTTTCTTCATTATCAGCCTGCTGCCGAGCTCGGGAAGGACCTCATAGACTTGGCCACTTT
T
AGGCCTCAGCCAACTGCCAGTGGACACCGCCCAGAGGAAGACGAAGAGGAGGAGATTGTGATTGGGTGG
CAG
GAGAAGCTCTTTAGCCAGTTTGAAGTAGATCTGTACCAAAATGAAACAGCCTGTCAGAGTCCTTTGG
AT
TATCAGTACCGTCAGGAGATCCTGAAGCTGGAGAATTCGGGTGGCAAGAAAAACCGACGAATCTTTAC
C
TACACTGACTCTGATAGATACACCAATTTGGAGGAGCACTGTCAGAGAATGACCACTGCAGCCAGCGAG
GTG
CCTTCATTCTTGGTCGAGCGAATGGCAAATGTCAGGCGTCGCCGGCAGGACAGGCGAGGGATGGAGG
GC
GGCATCCTCAAGTCACGCATCGTCACCTGGGAGCCCTCAGAAGAGTTTGTCAGGAACAACCACGTCAT
T
AACACCCCTCTTCAGACAATGCACATCATGGCAGACCTGGGGCCCTATAAAAAGCTTGGCTATAAGAAG
TAT
GAACATGTCCTGTGTACTCTGAAGGTGGATAGCAATGGTGTGATCACAGTAAAGCCTGACTTCACGG
GC
CTCAAAGGACCCTACAGGATTGAGACGGAGGGGGAGAAGCAGGAGCTGTGGAAATATACGATCGACAA
T
GTTTCCCCCCACGCACAGCCGGAGGAGGAGGAGCGGGAACGGCGAGTGTTCAAGGATCTTTATGGCCGG
CAC
AAGGAGTATCTCAGCAGCCTCGTAGGCACCGACTTTGAGATGACTGTCCCAGGTGCCCTCCGGCTCT
TT
GTAAATGGAGAGGTCGTTTCAGCCCAAGGCTATGAGTATGACAATCTCTACGTCCACTTCTTTGTAGA
A
TTGCCAACTGCTCACTGGTCAAGCCCAGCATTCCAGCAGCTCTCAGGAGTAACACAGACCTGCACCACC
AAG
TCCCTGGCAATGGACAAGGTGGCTCACTTCTCCTACCCATTCACGTTTGAAGCCTTCTTCCTCCATG
AG
GATGAATCTTCTGATGCACTCCCGGAGTGGCCTGTGCTCTACTGTGAGGTCCTCTCGCTGGACTTCTG
G
CAGAGGTACCGTGTGGAAGGCTATGGGGCTGTGGTGCTGCCTGCCACTCCAGGCTCACACACCCTGACA
GTC
TCCACGTGGAGACCTGTGGAGCTTGGCACGGTGGCTGAGCTGAGGAGGTTTTTCATTGGCGGTTCTC
TG
GAACTGGAGGACCTCTCCTATGTACGGATACCAGGATCCTTCAAGGGGGAACGCCTGAGCCGCTTTGG
A
CTCCGCACAGAGACCACAGGCACTGTCACCTTCCGCTTGCACTGTCTGCAGCAGTCCAGGGCCTTCATG
GAA
TCGAGCTCCCTTCAGAAAAGGATGCGGAGTGTGTTGGACCGTCTGGAAGGGTTCAGCCAGCAGAGTT
CC
ATTCACAATGTGCTAGAGGCCTTCCGTCGAGCCCGGCGCCGCATGCAGGAGGCCCGGGAAAGCCTCCC
G
CAGGACCTAGTGAGCCCCTCTGGAACCCTGGTCTCCTAG


Translation (549 aa):
MAVPVSSFAQRTRSRFRVHLQRITSSNFLHYQPAAELGKDLIDLATFRPQPTASGHRPEEDEEEEIVIGW
Q
EKLFSQ
FEVDLYQNETACQSPLDYQYRQEILKLENSGGKKNRRIFTYTDSDRYTNLEEHCQRMTTAASE
V
PSFLVERMANVRRRRQDRRG
MEGGILKSRIVTWEPSEEFVRNNHVINTPLQTMHIMADLGPYKKLGYKK
Y
EHVLCTLKVDSNGVITVKPDFTGLKGPY
RIETEGEKQELWKYTIDNVSPHAQPEEEERERRVFKDLYGR
H
KEYLSSLVGTDFEM
TVPGALRLFVNGEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTT
K
SLAM
DKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLT
V
STWRPVELGTVAELRRFFIGGSLELEDLSYVRIPGSFK
GERLSRFGLRTETTGTVTFRLHCLQQSRAFM
E
SSSLQKRMRSVLDRLEGFSQQSSIHNVL
EAFRRARRRMQEARESLPQDLVSPSGTLVS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser