NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52611.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52611.1 Public Mus musculus 8 Cd97 16 104 75 CCDS HistoryNCBI Gene:26364Re-query CCDS DB by CCDS ID:52611.1Re-query CCDS DB by GeneID:26364

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 52611.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000109802 ENSMUSP00000105427 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109802Link to Ensembl Protein Viewer:ENSMUSP00000105427Re-query CCDS DB by Nucleotide ID:ENSMUST00000109802Re-query CCDS DB by Protein ID:ENSMUSP00000105427
Original member Current member EBI,WTSI OTTMUST00000052856 OTTMUSP00000025114 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052856Link to Vega Protein Viewer:OTTMUSP00000025114Re-query CCDS DB by Nucleotide ID:OTTMUST00000052856Re-query CCDS DB by Protein ID:OTTMUSP00000025114
Original member Current member NCBI NM_001163030.1 NP_001156502.1 Accepted alive Link to Nucleotide Sequence:NM_001163030.1Link to Protein Sequence:NP_001156502.1Re-query CCDS DB by Nucleotide ID:NM_001163030Re-query CCDS DB by Protein ID:NP_001156502Link to BLink:NP_001156502.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001156502.1 773 Q9Z0M6-3 773 99.6119% 0 3

Chromosomal Locations for CCDS 52611.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

Chromosome Start Stop Links
8 83723873 83723902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83723979 83724077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83724192 83724360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83724438 83724529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83724618 83724687 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83724769 83724998 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83725155 83725346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83725865 83726029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83727745 83727968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83728095 83728211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83728281 83728440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83729057 83729134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83729257 83729303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83729382 83729525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83730111 83730257 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83733414 83733566 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83734009 83734125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83734296 83734352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83741107 83741137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2322 nt):
ATGAGGGGCGTCAGATGCCCCGGCCTGCTTGTGGTGTGCATTTTACTGAGTCTCTCAGGAGCTGGAACCC
AG
AAGGCAGAGAGTAAGAACTGTGCCAAGTGGTGCCCTATCAACTCAAAATGTGTCAGTAACAGAAGCTG
T
GTCTGCAAGCCCGGCTTCAGCTCGGAGAAGGAATTGATCACTAACCCTGCAGAGAGCTGTGAAGACATC
AAC
GAGTGTTTACTACCTGGATTTTCCTGTGGAGACTTTGCCATGTGTAAGAACTCAGAGGGGAGTTACA
CC
TGCGTCTGTAACCTGGGATATAAGCTCCTTTCTGGTGCAGAATCTTTTGTTAACGAGAGTGAGAATAC
A
TGTCAAGATGTGAATGAGTGCATCTCCGGGCAAAACCATTGCCACCAATCCACCCACTGCATCAACAAA
TTG
GGTGGCTATTCTTGCATCTGTCGTCAAGGCTGGAAACCTGTTCCTGGATCCCCCAATGGCCCTGTCA
GC
ACAGTGTGCGAAGATGTGGATGAGTGCAGCTCTGGGCAGCATCAATGTCACAATTCCACCGTCTGCAA
A
AACACCGTAGGCTCCTACAAGTGCCACTGCCGTCCAGGTTGGAAGCCAACTTCTGGGTCCCTCCGTGGT
CCA
GACACCATATGCCAAGAGCCACCGTTCCCTACTTGGACACTGCTGCCCACAGCCCACAGTCAGACTC
TC
TTGAGATTCTCTGTTGAAGTCCAGAATCTGCTCCGTGACTTCAATCCAGCCACGGTCAACTACACCAT
C
CAGAAACTCATCGAGGCTGTGGACAAGCTGCTGGAAGACCCCATGGAGACTGAAACCCAACAAGTAGCT
GCC
CAGTTGCTCTCGAACCTGGAACAAAGCCTTCGGACCTTGGCTCAGTTTTTACCCAAAGGCCCCTTCA
CC
TACACGTCCCCTTCAAATACTGAACTGTCCCTGATGGTGAAGGAGCAAGACAACAAAGATGTTACCAC
A
GTGCACCACGGCCAAACTTGGATGGAGCTGGACTGGGCTGTGACAGCTGGAGCCAAAATCTCAGAAAAT
G
GC
TCCTCGGTGGCAGGCATCCTGTCCAGCCCAAACATGGAAAAGCTGCTGGGCAACACCCCGCTGAACT
TG
GAGCAGAGAAGGGCCTCCTTGGAGGACTTCTATGGAAGCCCGATTCCGAGTGTCTCACTTAAGCTTCT
C
TCAAACATCAATTCTGTCTTCCTGACCAACACGAACACTGAAAAGCTCGCCTCGAATGTCACGTTCAAG
TTC
GACTTTACTTCTGTGGAGTCAATTGAGCCACGTCATGAGCTGATATGTGCCTTCTGGAAAGCCCACA
AC
GGGAATGGGTACTGGGACACCGACGGCTGCTCAATGAATGGCACTGGCTTCTGCCACTGCAACCACCT
G
ACCAGCTTTGCCATCCTAATGGCTCAGTACCATGTGCAGGACCCAAGGCTGGAATTGATCACCAAGGTG
GGG
CTGTTGTTGTCCCTGATCTGCCTGCTGCTGTGCATCCTGACCTTCCTGCTGGTGAAGCCCATCCAGA
GC
TCTCGAACCATGGTGCACCTGCACCTGTGCATCTGCCTCTTCCTGGGCTCAATCATATTCCTGGTCGG
C
GTGGAGAATGAAGGGGGTGAGGTGGGCCTGCGCTGCCGCCTGGTGGCCGTGATGCTGCATTTCTGCTTC
CTG
GCCGCCTTCTGCTGGATGGCACTGGAGGGCGTGGAGCTCTACTTCCTGGTGGTGCGTGTGTTCCAGG
GC
CAAGGCCTGAGTACATGGCAACGCTGCCTGATTGGCTACGGGGTGCCCCTCCTCATCGTGGCCATCTC
A
ATGGCAGTTGTCAAAATGGATGGCTATGGGCATGCAACATACTGCTGGCTGGACTTTAGGAAGCAGGGC
TTT
CTCTGGAGCTTTTCGGGACCCGTGGCCTTCATCATTTTCTGCAATGCTGCCATTTTCGTGATCACTG
TC
TGGAAGCTCACAAAGAAGTTTTCTGAAATCAACCCAAACATGAAGAAGTTAAGGAAGGCGAGGGTGCT
G
ACCATCACCTCCATCGCCCAGCTCCTTGTGCTGGGCTGCACCTGGGGCTTCGGCCTGTTCCTCTTCAAC
CCC
CATAGCACATGGCTATCCTACATCTTTACCCTGCTCAACTGCCTGCAGGGCCTATTCCTCTATGTGA
TG
CTCTGCCTGCTCAACAAAAAGGTGAGGGAAGAGTACTGGAAATGGGCCTGCATGGTCACTGGGAGCAA
G
TACACAGAGTTCAACTCTTCCACAACAGGCACTGGCACCAGCCAAACACGGGCTCTCAGGTCCTCAGAA
TCA
GGGATGTGA


Translation (773 aa):
MRGVRCPGLLVVCILLSLSGAGTQKAESKNCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCEDI
N
ECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQ
DVNECISGQNHCHQSTHCINK
L
GGYSCICRQGWKPVPGSPNGPVSTVCE
DVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRG
P
DTICQ
EPPFPTWTLLPTAHSQTLLRFSVEVQNLLRDFNPATVNYTIQKLIEAVDKLLEDPMETETQQVA
A
QLLSNLEQSLRTLAQFLPKGPFTYTSPSNT
ELSLMVKEQDNKDVTTVHHGQTWMELDWAVTAGAKISEN
G
SSVAGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPIPSVSLKLLSNINSVFLTNTNTEKLASNVTFK
F
DFTS
VESIEPRHELICAFWKAHNGNGYWDTDGCSMNGTGFCHCNHLTSFAILMAQYHVQDPRLELITKV
G
LLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCICLFLGSIIFLVGVENEGGE
VGLRCRLVAVMLHFCF
L
AAFCWMALEGVELYFLVVRVFQGQGLSTWQRCLIGYGVPLLIVAISMAVVKMDGYGHAT
YCWLDFRKQG
F
LWSFSGPVAFIIF
CNAAIFVITVWKLTKKFSEINPNMKKLRKARVLTITSIAQLLVLGCTWGFGLFLFN
P
HSTWLSYIFTLLNCLQGLFLYVMLCLLNKK
VREEYWKWACMVTGSKYTEFNSSTTGTGTSQTRALRSSE
S
GM




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser